2GMX,1UKI,3O2M


Conserved Protein Domain Family
STKc_JNK1

?
cd07875: STKc_JNK1 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. JNK1 is expressed in every cell and tissue type. It specifically binds with JAMP (JNK1-associated membrane protein), which regulates the duration of JNK1 activity in response to stimuli. Specific JNK1 substrates include Itch and SG10, which are implicated in Th2 responses and airway inflammation, and microtubule dynamics and axodendritic length, respectively. Mice deficient in JNK1 are protected against arthritis, obesity, type 2 diabetes, cardiac cell death, and non-alcoholic liver disease, suggesting that JNK1 may play roles in the pathogenesis of these diseases. Initially, it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes could survive but disruption of both genes resulted in lethality. However, recent studies have shown that JNK1 and JNK2 perform distinct functions through specific binding partners and substrates. JNKs are mitogen-activated protein kinases that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143380
View PSSM: cd07875
Aligned: 5 rows
Threshold Bit Score: 749.565
Threshold Setting Gi: 317455249
Created: 24-Sep-2008
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                       ####### #            # #                         
2GMX_B         1 MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCV 80
1UKI_A         1 MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCV 80
gi 30316067    1 MSRSKRDSNFSVFEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAFDAVLERHVAIKKLSRPFQNQTHAKRAYRELVLMKCV 80
gi 118092739   1 MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCV 80
3O2M_A         1 MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #                     #######                                           #  
2GMX_B        81 NHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVK 160
1UKI_A        81 NHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVK 160
gi 30316067   81 NHKNIIGLLNVFTPQKSLEEFQDLYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVK 160
gi 118092739  81 NHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVK 160
3O2M_A        81 NHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1               #                                                                        
2GMX_B       161 SDCTLKILDFGLARTAGTSFMMEPEVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVChKILFPGRDYIDQWNKVIEQ 240
1UKI_A       161 SDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKgGVLFPGTDHIDQWNKVIEQ 240
gi 30316067  161 SDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCILGEMIKgGVLFPGTDHIDQWNKVIEQ 240
gi 118092739 161 SDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKgGVLFPGTDHIDQWNKVIEQ 240
3O2M_A       161 SDCTLKILDFGLARTAGTSFMMEPEVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVChKILFPGRDYIDQWNKVIEQ 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2GMX_B       241 LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPY 320
1UKI_A       241 LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPY 320
gi 30316067  241 LGTPCTEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDDALQHPY 320
gi 118092739 241 LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPY 320
3O2M_A       241 LGTPCPAFMKKLQPTVRNYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPY 320
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
Feature 1                                                    
2GMX_B       321 INVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLE 364
1UKI_A       321 INVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLH 364
gi 30316067  321 INVWYDPLEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVLDWE 364
gi 118092739 321 INVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLE 364
3O2M_A       321 INVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLE 364

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap