3E7O


Conserved Protein Domain Family
STKc_JNK2

?
cd07876: STKc_JNK2 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. JNK2 is expressed in every cell and tissue type. It is specifically translocated to the mitochondria during dopaminergic cell death. Specific substrates include the microtubule-associated proteins DCX and Tau, as well as TIF-IA which is involved in ribosomal RNA synthesis regulation. Mice deficient in Jnk2 show protection against arthritis, type 1 diabetes, atherosclerosis, abdominal aortic aneurysm, cardiac cell death, TNF-induced liver damage, and tumor growth, indicating that JNK2 may play roles in the pathogenesis of these diseases. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes could survive but disruption of both genes resulted in lethality. However, recent studies have shown that JNK1 and JNK2 perform distinct functions through specific binding partners and substrates. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143381
View PSSM: cd07876
Aligned: 3 rows
Threshold Bit Score: 735.297
Threshold Setting Gi: 30315985
Created: 24-Sep-2008
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                   ####### #            # #                            
3E7O_A        2 SHMDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHK 81
gi 30315985   4 SKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHK 83
gi 47214351   1 SEEEGQFYSVQVGDSTFTVLKRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLCRPFQNQTHAKRAYRELVLLKCVNHK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #                     #######                                           #     
3E7O_A       82 NIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDC 161
gi 30315985  84 NIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDC 163
gi 47214351  81 NIIRLINVFTPQKSLEEFQDLYLVMELMDANLCQVIHMDLDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDC 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #                                                                           
3E7O_A      162 TLKILDFGLARTASTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGSVIFQGTDHIDQWNKVIEQLGT 241
gi 30315985 164 TLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGT 243
gi 47214351 161 TLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEVLGT 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
3E7O_A      242 PSAEFMAALQPTVRNYVENRPAYPGIAFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITV 321
gi 30315985 244 PSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSQARDLLSKMLVVDPDKRISVDEALRHPYITV 323
gi 47214351 241 PSLEFMNRLMETVRNYVMNKPQYHGVSFTELFPDWAFPSDSEHDKLKTSQARDLLSKMLVIDPECRISVEEALNHPYIHV 320
                       330       340       350
                ....*....|....*....|....*....|....*....
Feature 1                                              
3E7O_A      322 WYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMD 360
gi 30315985 324 WYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMD 362
gi 47214351 321 WYDPAEADAPPPQISDKQLEEREHTIEQWKELIYEEVID 359

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap