2FST,1LEZ,1ZZ2,1BL7,1LEW,2NPQ,1YWR,3HVC,3NEW,3PY3


Conserved Protein Domain Family
STKc_p38alpha

?
cd07877: STKc_p38alpha 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase (also called MAPK14)
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. p38alpha/MAPK14 is expressed in most tissues and is the major isoform involved in the immune and inflammatory response. It is the central p38 MAPK involved in myogenesis. It plays a role in regulating cell cycle check-point transition and promoting cell differentiation. p38alpha also regulates cell proliferation and death through crosstalk with the JNK pathway. Its substrates include MAPK activated protein kinase 2 (MK2), MK5, and the transcription factors ATF2 and Mitf. p38 kinases MAPKs, serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 143382
View PSSM: cd07877
Aligned: 13 rows
Threshold Bit Score: 771.517
Threshold Setting Gi: 326327986
Created: 24-Sep-2008
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 23 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                ##   # ##            # #                     #        # 
2FST_X        13 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 92
1LEZ_A         6 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85
1ZZ2_A         6 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85
1BL7_A        25 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 104
1LEW_A         6 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85
2NPQ_A        13 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 92
1YWR_A         6 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85
3HVC_A         8 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 87
gi 1346567     7 YVFYRQELNKTLWEVPDRYQNLTPVGSGAYGSVCSSFDTRTALRIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 86
gi 30316123    7 PTFYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPFQSIIHAKRTYRELRLLKHMRHENVIG 86
gi 118102270   6 PKFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCSAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 85
3NEW_A        12 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 91
3PY3_A        26 PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIG 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #                 # ####  #                                     # # ##          
2FST_X        93 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 172
1LEZ_A        86 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165
1ZZ2_A        86 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165
1BL7_A       105 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 184
1LEW_A        86 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165
2NPQ_A        93 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 172
1YWR_A        86 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165
3HVC_A        88 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 167
gi 1346567    87 LLDVFSPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELK 166
gi 30316123   87 LLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 166
gi 118102270  86 LLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 165
3NEW_A        92 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELK 171
3PY3_A       106 LLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELK 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ## #                                                                           
2FST_X       173 ILDFGLARHTADEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 252
1LEZ_A       166 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 245
1ZZ2_A       166 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 245
1BL7_A       185 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 264
1LEW_A       166 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 245
2NPQ_A       173 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 252
1YWR_A       166 ILDFGLARHTDDEMAGFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 245
3HVC_A       168 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 247
gi 1346567   167 ILDFGLARHTDEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPEPE 246
gi 30316123  167 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPSS 246
gi 118102270 166 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGPE 245
3NEW_A       172 ILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 251
3PY3_A       186 ILDFGLARHTDDEMXGXVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2FST_X       253 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 332
1LEZ_A       246 LLKKIsSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 325
1ZZ2_A       246 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 325
1BL7_A       265 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 344
1LEW_A       246 LLKKIsSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 325
2NPQ_A       253 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 332
1YWR_A       246 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 325
3HVC_A       248 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 327
gi 1346567   247 LLQKIsSEAARNYIQSLPYMPKMNFEDVFLGANPQAVDLLEKMLVLDTDKRITAAEALAHSYFaQYHDPDDEPiaEPYDQ 326
gi 30316123  247 LISRMpSHEARTYISSLPQMPKRNFADVFIGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFaQYHDPDDEPeaEPFDQ 326
gi 118102270 246 LLKKIsSESARNYIQSLSYMPKMNFENVFIGANPLAVDLLEKMLVLDTDKRITAAEALAHAYFaQYHDPDDEPvaDPYDQ 325
3NEW_A       252 LLKKIsSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 331
3PY3_A       266 LLKKIsSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFaQYHDPDDEPvaDPYDQ 345
                        330       340
                 ....*....|....*....|....*
Feature 1                                 
2FST_X       333 SLESRDLLIDEWKSLTYDEVISFVP 357
1LEZ_A       326 SFESRDLLIDEWKSLTYDEVISFVP 350
1ZZ2_A       326 SFESRDLLIDEWKSLTYDEVISFVP 350
1BL7_A       345 SFESRDLLIDEWKSLTYDEVISFVP 369
1LEW_A       326 SFESRDLLIDEWKSLTYDEVISFVP 350
2NPQ_A       333 SFESRDLLIDEWKSLTYDEVISFVP 357
1YWR_A       326 SFESRDLLIDEWKSLTYDEVISFVP 350
3HVC_A       328 SFESRDLLIDEWKSLTYDEVISFVP 352
gi 1346567   327 SFESRELDIEEWKRLTYEEVTCFVP 351
gi 30316123  327 SFESRELDIEEWKRQTYEEMISFEP 351
gi 118102270 326 SFESRELEIEEWKSLTYDEVISFVP 350
3NEW_A       332 SFESRDLLIDEWKSLTYDEVISFVP 356
3PY3_A       346 SFESRDLLIDEWKSLTYDEVISFVP 370

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap