Conserved Protein Domain Family
SER_beta

?
cd10556: SER_beta 
Beta subunit of selenate reductase
This subfamily includes beta FeS subunit of selenate reductase (SER), a member of the DMSO reductase family. SER catalyzes the reduction of selenate to selenite in bacterial species that can obtain energy by respiring anaerobically with selenate as the terminal electron acceptor. The enzyme comprises three subunits SerABC, forming a heterotrimer, with the catalytic component (alpha-subunit), iron-sulfur protein (beta-subunit) and monomeric b-type heme-containing gamma subunit. Beta subunit contains coordinating one [3Fe-4S] cluster and three [4Fe-4S] clusters and functions as electron carrier.
Statistics
?
PSSM-Id: 319878
View PSSM: cd10556
Aligned: 8 rows
Threshold Bit Score: 486.197
Threshold Setting Gi: 490731888
Created: 20-Feb-2014
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Fe-S cluster
Feature 1:Fe-S cluster binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                            #######   #   #          ## #                               
gi 494420717   3 YPYFESRPKKQFAAIFNINRCIACQTCTMACKSAWTYNKGQEYMWWNNVETKPYGGYPQSWDVktlk---lidnGENTWy 79
gi 490731888  17 YEHREEERDYHWGMVINTNRCINCNTCSFACKSTWTSGEGEEYMWWMNVETEPYGGYPMGWDMrlld----dleADQTIf 92
gi 517043535  15 YPYEGMRPRRQFAMILDTNKCIACQTCTVACKTTWTAGRGQEYMLWNNVETKPYGYYPLGWDVnil------drQGVQT- 87
gi 557791782   2 YPYEERHPKWQFAFVFNINRCLACQTCSMADKSTWLFSKGQEYMWWNNVETKPYGGYPQFYDVkitqlieqvnpGGQVWn 81
gi 952340055  15 YPYPESHPDRQFAFVFNINRCIACQTCSMACKSTWTFSKGQELMWWNNVETKPYGGYPRHWDVkvl------elLDEANs 88
gi 630828628  15 YKFQDIPPDKQVAWIFDTNKCIACQTCTIACKNAWTAGKGQEFMFWNNVESKPWGFYPLGWDVrll------eeLGPQT- 87
gi 288788416  15 YPYEPKRPKKQFAVVMDLNKCIACQTCTIACKTTWTSGRGQEYMLWNNVETKPWGFYPLGWDA-----------KLLEL- 82
gi 408449795  15 YPYEEARPDDQWAGVFDLNKCIECQTCTLACKTTWTHEEGQEHMFWNNVETKPYGSHPVGWDQrlv-----eelGEMEW- 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 494420717  80 tdek---------deklSPYGVYEGDTIFEAsakk------------nlnqWAVGYIPEDKEWRapnfgedvaksnn--- 135
gi 490731888  93 daaeng----eqvrgyiAEKQAWEYPALGDD--------------------QVHGEYPEGEVVEsdlen----------- 137
gi 517043535  88 -----------------MDGPVYHGKTLFEAape---------------geVVLGYRPKDEDYAypnvgeddctge---- 131
gi 557791782  82 vrvg---------rkhhAPYGVFEGMTIFDAgak--------------vgqAAIGYIPTDQEWRfvniyedtatsmraiv 138
gi 952340055  89 tagvepswqpttaadreAPYGSYDGMTIFEAaaaet-----------ppvrQAVGYQPAPDEWSapnifedvphpgrpap 157
gi 630828628  88 -----------------WSGGKYTGKTIFEGapy---------------geEILGYHPDEKDYSypnlgedevnlq---- 131
gi 288788416  83 -----------------LEGDKKTVFDAPEGe-------------------RVLGWKPEDMDWMypnigedevnepv--- 123
gi 408449795  89 -----------------DEDGTYEGETIFEAkgaewigdgsdikddgsaadDMAGFRPSTDDWRypnlgedepagee--- 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                       #  ####  ###   ###  #        # #    #######   # #
gi 494420717 136 -------------kpdeysslpehsRWFFYIQRLCNHCTYPGCLAACPRKAIYKRKEDGIVLIDQKRCRGYRKCVEQCPY 202
gi 490731888 138 --------------------deyhdIWQFYLPRLCNHCKNPACLAACPRKAIYKREEDGIVLLDQERCRGYRRCVKACPY 197
gi 517043535 132 -------------mgqgawlsmphmQWMYYLPRICNHCTYPACLSACPRKVIYKREEDGIVLLDQNRCRGYRECVTGCPY 198
gi 557791782 139 egidksgfsrdepweltgsslpeheTFFFYLQRICNHCTYPGCLAACPRKAIYKRPEDGIVLIDQNRCRGYKKCVEQCPY 218
gi 952340055 158 ---------gslgleqdgaqlpehvAWFFYLQRLCNHCTYPACLAACPRKAIYKRPEDGIVLIDQARCRGYRKCVEACPY 228
gi 630828628 132 -------------vkdgdyikiphqPWMFYLQRICNHCSHPACLAACPRKAIYKRKEDGIVLIDQDRCRGYQECVRACPY 198
gi 288788416 124 -------------digtvlenfphpIWMFYLPRICNHCTYPACVAACPRQAIYKREEDGIVLIDPERCEGYQECVKACPY 190
gi 408449795 149 ------------mtpnthfdesthpVWFFYLPRICNHCTYAACAGSCPAQAIYKREEDGVVLIDEDNCVAWQQCNEACPY 216
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          #        # #####                 ###   ### ##                                 
gi 494420717 203 KKPMYRGLTRVSEKCIACYPRIEGKDPltkgrpmeTRCMSACVGQIRLQGFLDDNPK---------------NPVTWLIR 267
gi 490731888 198 HKPMYNPETGVTEKPVGCYPRIEEGNV--------PRCVSSCIGKTRLHGNINRGPDagpaggkssaasgrsPINYLVHS 269
gi 517043535 199 KKVFFNPMTRVSEKCIGCYPAIENDRQ--------TQCTITCIGKIRLQGFITTPDQar-----------edNPMDYIIH 259
gi 557791782 219 KKPMYRGTTRVSEKCIACYPRIEGKDPltggepmeTRCMAACVGKIRLQSLVRIGEDglwa-------edrwHPLYFAIR 291
gi 952340055 229 KKSMYRPTTRVSEKCVACYPRIEGRDPlsdgmpmeTRCMSACPGKIRLQGLVALDADgswa-------ddpqNPIVFMVR 301
gi 630828628 199 KKPMFRAYTGKSEKCISCYPAVEQGKQ--------TQCVQNCIGKIRMFGYISNLKEpr-----------qdNPIDYLVH 259
gi 288788416 191 KKTMFNFVARISQKCIGCFPRVEEGLQ--------PQCVITCIGKIRLMGFISPPEKar-----------peNPIDFLVH 251
gi 408449795 217 KKAIYNMQEGISQKCVGCYPKTEEGKA--------PQCFESCIGKIRLHGYINTPDEanvgdp----sdervNPVDFLVH 284
                        330       340       350
                 ....*....|....*....|....*....|....*.
Feature 1                                            
gi 494420717 268 HHKVALPLYPQFGTEPNIYYIPPRWAPRSYLRQMFG 303
gi 490731888 270 DEKVALPLYPQFGTQPQVFYMPPYHVPPEFLTQMFT 305
gi 517043535 260 VAKVARPLYPQFGLEPNTYYIPPVHVPPEYLRQMFG 295
gi 557791782 292 VEQVALPLYPQWGTEPNGFYIPPRHAPRGYTRQMFG 327
gi 952340055 302 HEKVALPLYPQFGTEPNGFYIPPRWAPRDYLVQMFG 337
gi 630828628 260 IKKIALPLYPQFGTGPNVYYIPPIHVPEGFNRQLFG 295
gi 288788416 252 IKKVALPIYPQTGLEPNVYYIPPINVPIRFLKQMFG 287
gi 408449795 285 KKEIALPLYPQFGLEPNVYYIPPITAPTDYLTQMFG 320

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap