Conserved Protein Domain Family
7tmE_cAMP_R_Slime_mold

?
cd14940: 7tmE_cAMP_R_Slime_mold 
slime mold cyclic AMP receptor, member of the class E family of seven-transmembrane G protein-coupled receptors
This family represents the class E of seven-transmembrane G-protein coupled receptors found in soil-living amoebas, commonly referred to as slime molds. The class E family includes cAMP receptors (cAR1-4) and cAMP receptors-like proteins (CrlA-C) from Dictyostelium discoideum, and their highly homologous cAMP receptors (TasA and TasB) from Polysphondylium pallidum. So far, four subtypes of cAMP receptors (cAR1-4) have been identified that play an essential role in the detection and transmit of the periodic extracellular cAMP waves that regulate chemotactic cell movement during Dictyostelium development, from the unicellular amoeba aggregate into many multicellular slugs and then differentiate into a sporocarp, a fruiting body with cells specialized for different functions. These four subtypes differ in their expression levels and patterns during development. cAR1 is high-affinity receptor that is the first one to be expressed highly during early aggregation and continues to be expressed at low levels during later developmental stages. cAR1 detects extracellular cAMP and is coupled to G-alpha2 protein. Cells lacking cAR1 fail to aggregate, demonstrating that cAR1 is responsible for aggregation. During later aggregation the high-affinity cAR3 receptor is expressed at low levels. Nonetheless, cells lacking cAR3 do not show an obviously altered pattern of development and are still able to aggregate into fruiting bodies. In contrast, cAR2 and cAR4 are low affinity receptors expressed predominantly after aggregation in pre-stalk cells. cAR2 is essential for normal tip formation and deletion of the receptor arrests development at the mound stage. On the other hand, CAR4 regulates axial patterning and cellular differentiation, and deletion of the receptor results in defects during culmination. Furthermore, three cAMP receptor-like proteins (CrlA-C) were identified in Dictyostelium that show limited sequence similarity to the cAMP receptors. Of these CrlA is thought to be required for normal cell growth and tip formation in developing aggregates.
Statistics
?
PSSM-Id: 320094
View PSSM: cd14940
Aligned: 13 rows
Threshold Bit Score: 285.399
Threshold Setting Gi: 74855511
Created: 22-Dec-2011
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:TM helix 1 [structural motif]
Evidence:
  • Comment:All members of this receptor family contain a seven-transmembrane helix domain.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #########################                                                      
gi 166201915   9 LTYSILVIADFSSIFGCLLVLIAFKKLKLLRNHITRVIACFCVSSLLKDIISTgltlslgpqneagstsFQCYLYAITIT 88
gi 193290459  39 ALYAILLIADVTSIIGAFIVLIGFWRLKLLRNHVTRVISCFCITSFCKDLTAMtltitn----saqyggFPCYLYSIVIT 114
gi 74849178   30 LLYSVLLLADITSIIGTFIVLIGFWRLKLLRNHVTRVISCFCLTSFLKDLMSMtltltd----saqyggFPCYLYSIVIT 105
gi 193290461  12 AQYVVLLFADFTSIIGCFCVLVGFWRLKLLRNHITRIISCFCLTSFFKDLISCiltltq----shrendFSCYLFAIAIN 87
gi 115617     12 TSLVLLLFADFSSMLGCMAVLIGFWRLKLLRNHVTKVIACFCATSFCKDFPSTiltltn----tavnggFPCYLYAIVIT 87
gi 74860191   10 ATYAVLLIADFTSIIGCIIVLVGFWRLKLLRNHVTKVISCFCLTSICKDVPSTlltltqa---avynrgFPCYFYSIVIT 86
gi 166214929   9 AQRTILLIADFSSIIGCSLVLIGFWRLKLLRNHITKIISLFCATSLFKDVISTiitllyk--pdqtesgFPCYLHAIVIT 86
gi 543929     22 ASYAVLLIADFTSIIGCTLVLLGFWRLKLLRNHITKIITFFCSTSLAKDLISTiltliek---kqsngsFQCYLYATVIT 98
gi 328873156  13 ALYGMLLLADFSSIVGCLTVLLGFWRLKLLRNHITRVIACFCVTSAIKDFVAVtltlsk----syatnkFACYVYAVDIT 88
gi 328871251   9 LIYALLLLADFSSLIGCAVVLLGFWKLKLLRNHITKIISCFCATSFLKDIIATsltlegt---afktkkWACYLYAASIN 85
gi 229277996  38 VIVGIRKTVASLSLIGCLFMIGVIWLFRKYRSFVQRLILYLSIAALLDDIAYLmgdl--------hpdgTLCNFQAFLLT 109
gi 556110230  20 IVIQARQVIAVFSLVGCLFVIFVIWLFKKYIVFAQRLILYLCIGACMDSIAYImgdm--------rpdsPLCNFEGWFLQ 91
gi 74855511   69 SLDKIVYFSSTMGIVGALFIIVSFFLFKAARTFATKMIFFLSLSDLFAAIFYLpyyr---------dsdIMCNLQGMGLV 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 166201915  89 YGSLACWLWTLCLAFSIYNLIVKRepEPEKYEKFYHGVCWTIPLICVIVMLAkkt-iePVGNWCWiSEKYVGYRFGLFYG 167
gi 193290459 115 YGSLSCWLWTLCLAVSIYLLIVKRypEPERLERYYFFICWGLPLISTITMLAkdt-vhFLGNWCWiGEQYTGYRFGLFYV 193
gi 74849178  106 YGSLSCWLWTLCLAISIYLMIVRRypEPEKLERYYFFVCWGLPLISTIIMLSkdl-vhFLGNWCWiGEQYTPYRFALFYV 184
gi 193290461  88 YGSLSCWLWTLCLAVSIYLLIVKRiqEAERLEKYYYLICWGLPLISTIIMLAkgl-veRVVGWCWiGGQYTAYRFGIFYV 166
gi 115617     88 YGSFACWLWTLCLAISIYMLIVKRepEPERFEKYYYLLCWGLPLISTIVMLAknt-vqFVGNWCWiGVSFTGYRFGLFYG 166
gi 74860191   87 YGSLSCWLWTLCLAISIFRLIVKRepEPQRYEKWYYLASWGLPIISTIIMLAknt-vdYVGNWCWiKPEYVVYRFMLFYV 165
gi 166214929  87 FGSLACWLWTLMLSFSIYNLIVRRepEPERFEKFYFCLCYGLPLISTIVMLSthi-iqPVGGWCWiGDNYDGYRFGLFYG 165
gi 543929     99 YGSLACWLWTLCLSFSIYNLIVKRepEPEKFEKYYHVFCWVVPFIMSVIMLSkgv-ieVTGNWCWiGNTYVGYRFGLFYG 177
gi 328873156  89 FGSFSCWMWTLCLALSIYLVLVRThhEPERLEKFYMIASWGLPLISCIIMVSvdglvmNVGSWCWiGQQYQGYRFGLFYI 168
gi 328871251  86 FGSFSCWMWTLCLALSIYLLISRVqiNQRKFEIIYMVVSWGLPAISTIIMLStni-vsNVGSWCWiGTKFVYFRFGLFYI 164
gi 229277996 110 FFEWSVLLWVCCITFNLTLNIIWMt-RTDKYEIVYHVLSWGVPLILACLPFIghh-ygPAGAWCWiPNQYTHWRFAIWYG 187
gi 556110230  92 YFDGTVLLWVLVITINLYFNVVKEr-VTEKFEWVYHAVCWIVPLLISFLPFIgdh-ygPAGAWCW-IIENWRWRLGVWYG 168
gi 74855511  140 FFLSSSYLWTMCISISLFMVFFTTifELNHWFKYFHFICWGIPLFTAIISLIfha-ygKTGSWCF-ISDPTSIFRLLYYL 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 166201915 168 PFFAIWIISAVLVGLTSRYTYsvirnsv-------sdnkdkhMTYQFKLINYIIVFLLCWVFAIVNRILNGLgy--ypTL 238
gi 193290459 194 PFFIIFGVSAILVGLTCHYTYqvihkgv-------sdnkdkhITYQFKLVNYIIVFLVCWIFAVINRILNAFgv--fpYI 264
gi 74849178  185 PFFIIFGVSAILVGLTCHYTYqvihngv-------sdnkdkhITYQFKLVNYIIVFLVCWIFAVINRILNAIgl--fpYA 255
gi 193290461 167 PFFIIFATSAVLVGLTCQYTYnvihngv-------sdnkdrhITYQFKLVNYIIVFLVCWIFAVVNRIINSLni--fdYT 237
gi 115617    167 PFLFIWAISAVLVGLTSRYTYvvihngv-------sdnkekhLTYQFKLINYIIVFLVCWVFAVVNRIVNGLnm--fpPA 237
gi 74860191  166 PFFIIFGTSAILVGITCHYTYqvihngv-------sdnkdrhVKYQFKLVNYIIVFLICWVFAVVNRIVNGLgy--ypFA 236
gi 166214929 166 PFFFIWGTSAILVGLTSKYTYsvirssv-------sdnkdkhMTYQFKLINYIVVFLVCWVFAIVNRILNGLnq--fpTV 236
gi 543929    178 PFLAIWFLAAVLVGLTSRYTYkvirssv-------sdnkdrhMTYQFKLINYIIVFLLCWVFAVINRIVNGLnm--fpAW 248
gi 328873156 169 PMFIIYAGAVLLTGLTMYYTYtviykneq------stkkaehRKYQFKLVNYIVVFLVCWIFAVINRILNAYnl--niYA 240
gi 328871251 165 PFFVIFGAAAILVGLTSHYTYvvmhnskf------vrnenhhAVYQFKLVNYIIVFLICWVFAVVNRILNAVnl--niYA 236
gi 229277996 188 PLFCLLGLMVVVYTCITVTLNrkvkrwegtydpdvernkemlKEDIKPLRAYPFIYLALSIFPLVHRIQNAIspdtmvFA 267
gi 556110230 169 PLFIIIIFLFVVYTYIFIVLKrkastwegmynpdiernqrllKEDIKPLKFYPFVYLLVSIFPLINRIQNAIsphnhvFA 248
gi 74855511  218 PLIVVFFINLVVFIAIRWKISqhsn--------------slvSRVNIIVSFYLIAFSLSQLPTIINSIQNFSdpdnpqFS 283
                        250       260       270
                 ....*....|....*....|....*....|
Feature 1                                      
gi 166201915 239 PNILHTYFSVSHGFFASVTFIYNNPLMWRY 268
gi 193290459 265 CNVLHTYLSVSHGFFASAVFIYNNPLMWRY 294
gi 74849178  256 CNLLHTYLSLSHGFYASVAFIYNNPLMWRF 285
gi 193290461 238 CNMLHTYLSISHGFYASLVFIYNNPLMWRY 267
gi 115617    238 LNILHTYLSVSHGFWASVTFIYNNPLMWRY 267
gi 74860191  237 TNLLHTYLSVSHGFFASMVFVYNNPLMWRY 266
gi 166214929 237 PNVLHTYFSVSHGFYASITFIYNNPLMWRY 266
gi 543929    249 VSILHTYLSVSHGFYASVTFIYNNPLMWRY 278
gi 328873156 241 TNLLHTYLSISHGFYASLVFIYNNPVMWRY 270
gi 328871251 237 TNVLHTYLSVSHGFYASLVFIYNNPIMWRF 266
gi 229277996 268 LVVLHALTSPLQGMVNAIVYGLDRETIVRL 297
gi 556110230 249 LVLLASIFAPLHGALIAVVFGMDIETIKRL 278
gi 74855511  284 LFAFQLLLQPLQGFLNCVVYGINEGFINHY 313

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap