4DKL,4EJ4,4DJH,4EA3


Conserved Protein Domain Family
7tmA_Opioid_R-like

?
cd14970: 7tmA_Opioid_R-like 
Click on image for an interactive view with Cn3D
opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.
Statistics
?
PSSM-Id: 320101
View PSSM: cd14970
Aligned: 15 rows
Threshold Bit Score: 320.396
Threshold Setting Gi: 229290295
Created: 10-May-2005
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 41 residues -Click on image for an interactive view with Cn3D
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:
  • Comment:based on the structures of some class A family members with bound ligands (peptides or chemicals), agonists, or antagonists
  • Comment:Small-molecule chemical ligands tend to bind deeper within the receptor core, compared to a peptide ligand neurotensin, which binds towards the extracelllular surface of its receptor.
  • Structure:4DKL: Mouse mu-opiod receptor binds a morphinan antagonist, contacts at 4A.
    View structure with Cn3D
  • Structure:4EJ4: human delta-opioid receptor binds Naltrindole, contacts at 4A.
    View structure with Cn3D
  • Structure:4DJH: human kappa-opioid receptor in complex with Jdtic, contacts at 4A.
    View structure with Cn3D
  • Structure:4EA3: human nociceptin/orphanin FQ receptor in complex with a peptide mimetic, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                  #  ##            #####
4DKL_A        18 ITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTa---TNIYIFNLALADALATSTLPFQSVNYLMGt-WPFGnilCKIVI 93
gi 33860175  110 IIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWcnnvPDIFIINLSVVDLLFLLGMPFMIHQLMGNgvWHFGetmCTLIT 189
gi 229291454  36 IIIPVFYCVVSAIGLTGNTLVIYVVLRYAKLKTv---TYMYIMNMACADELFLLSLPFLAAYYALHn-WPFGlvvCKVVL 111
gi 229281440  38 IVAPTVYSVESVAALLGNALVIYMLLGFTKMKDa---THYYILNLAVADALFMLGVPFITVSSAMEg-WPFGnamCKIVQ 113
gi 229290295  23 LVLSAFYMMLLVMGMVGNVVVIFVILKVSGKKKeakmADVLVMNLAVSDILLLSILPFMIIDLIVGe-WTFSqelCKFVV 101
gi 229290296  94 TVLPILYCFLCAFGLSGNVLVIYVVSNFSKMRTv---ANVYLLNLAVADVLFLLVLPFLATDVILMa-WPFGdfmCRSVV 169
gi 229297231  68 IAIPIVYSVVCILGLIGNSLVISVILRFEKMKTi---ANIYILNLAIADELFMLSLPFFVVSILLEd-WPFGdvmCRVVL 143
gi 61743877   34 VLIPIFYILVCAVGLSGNTLVIYVVLRYAKMKTv---TNIYILNLAVADVLFMLGLPFLATQNAISy-WPFGsflCRLVM 109
gi 229290294  32 VVLPVFYSVIFVVGLFGNFVVITVILKYHKMRSv---ANMYILNLAIADLCLLCILPFLTTNVFLGy-WPFGgvmCKVVV 107
gi 229275329  27 VIIPIVYGIISLIGLTGNSLVIYVVMKYARVKSv---TYLYILNLALADELFVLLLPLSAASIGLEt-WPFGtvmCKIAL 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        # ##  #                                            # #####                      
4DKL_A        94 SIDYYNMFTSIFTLCTMSVDRYIAVCHPvkALDFRtPRNAKIVNVCNWILSSAIGLPVMFmattk----yrqgSIDCTlt 169
gi 33860175  190 AMDANSQFTSTYILTAMAIDRYLATVHPisSTKFRkPSVATLVICLLWALSFISITPVWLyarli---pfpggAVGCGir 266
gi 229291454 112 SVDALNQFTSIFCLVVMSFDRYLAVVHPvkSVGYRtPSMARYVNISVWAVSLVMTLPVAIfattne-gkklpdGVSCNlh 190
gi 229281440 114 SMDAMNMFNSVFSLAVLSVDRYLAIVRAtsHPHLRqPKVAVAVSLSVWAASILLSIPVMTasdtv---tledgTDICIln 190
gi 229290295 102 GAVNAGAFAGFLSLAALSVDRYHAMAYPlkSLRLEdHKKTATVLFLLWSLAICTCIPHIWyarvl---vysggTSHCVle 178
gi 229290296 170 LATNINGFASFFSLAVLSVDRYYATVQPlqSLQHRtVSKARWVSVGVWTVALVLVCPFIVfarta---kdtsgAEHCIvd 246
gi 229297231 144 TVDAMNMFTSCCCITAMSVDRYLAIVHPmkSLRWRtPCRAKLTCLCIWLASCAIICPVPYfagve----afvdTTGCMlq 219
gi 61743877  110 TVDGINQFTSIFCLTVMSMDRYLAVVHPikSTKWRrPRVAKLISMTVWTFSFLVVLPVFIfsdv------qedFHTCNmn 183
gi 229290294 108 GASNLNGFASFLFLMTLSIDRYHAMVHPlkSRKYRtIRRCKWACLAVWTGGLLMDLPYIIfantl---eeqqqKLQCIld 184
gi 229275329 103 YVDTLNQFVSIFCLTVLSVDRFVAVACPviSVNRRnTRMARTVNISVWAISLVVSSPVVIfantdtaeqhethLITCNlh 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #  ### ### ##                                                        
4DKL_A       170 fsh---ptwywENLLKICVFIFAFIMPVLIITVCYGLMILRlksvrnifemlrideglrlkiykntegyytigighlltk 246
gi 33860175  267 lpn----pdtdLYWFTLYQFFLAFALPFVVITAAYVRILQRmtssvap-------------------------------- 310
gi 229291454 191 wpd----ktigSHVFTTFTFVFGFAVPLSIIVASYILLTRRlrslsnk-------------------------------- 234
gi 229281440 191 wpan--eamywHKVLTSYTFVVGFIIPFTVISVSYLLVVRHlklttseh------------------------------- 237
gi 229290295 179 lpataedpnlwHRVSVAYSFIVGFVVPLIIIITCYSLIIHSisssdvlstpdrsdglv---------------------- 236
gi 229290296 247 wpgtiddptfgSQLAVTYSFVLGFAVPLLFIAVCYTLIIFRlrakgpi-------------------------------- 294
gi 229297231 220 wp-----gdswARAWIVYCIILGFLLPVVVITICSVKIAKAlgrqanqlifegd-------------------------- 268
gi 61743877  184 wpe---pvniwSAAFIIYTSVLGFFGPLLVICLCYLLIVIKvkssgir-------------------------------- 228
gi 229290294 185 wp-----nqyvEQLATVFSFVIGFAIPVTVIIVCYWAILVClrrsdqpsl------------------------------ 229
gi 229275329 183 wpeh--vsstmGEAWVIYTFTLGFAVPLIVIVTCYSLMTRRlcdsvkgtstt---------------------------- 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4DKL_A       247 spslnaakseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagft 326
gi 33860175      --------------------------------------------------------------------------------
gi 229291454     --------------------------------------------------------------------------------
gi 229281440     --------------------------------------------------------------------------------
gi 229290295     --------------------------------------------------------------------------------
gi 229290296     --------------------------------------------------------------------------------
gi 229297231     --------------------------------------------------------------------------------
gi 61743877      --------------------------------------------------------------------------------
gi 229290294     --------------------------------------------------------------------------------
gi 229275329     --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                             #  ## ##  #
4DKL_A       327 nslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayekdRNLRRITRMVLVVVAVFIVCWTPIHIYVIIK 406
gi 33860175  311 ------------------------------------------asqrsirLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQ 348
gi 229291454 235 ------------------------------------------thsrekeRAYRRIERLVYTVVFVFVMCWMPFYVFQIGS 272
gi 229281440 238 -----------------------------------------eavarvsaGMRTKVTKTVTAMTVTFAACWLPFHMCQMIL 276
gi 229290295 237 ---------------------------------paggrqqnpghaarvhRHKKLRSRLVLMLVAAFVLCWLPYHVFHIVR 283
gi 229290296 295 ------------------------------------------ppngvaaRSRNKITVMVCAVVLAFTICWLPYHIFNIVR 332
gi 229297231 269 -------------------------------------vklsasrrqqeaRRKHKVTKMILAVIVTFVVCWLPFYVGQIVN 311
gi 61743877  229 ------------------------------------------vgstrrrRSERKVTRMVVIIVVVFVFCWLPFYMMNIVN 266
gi 229290294 230 ----------------------------------------qlrcsassqASRRRLTVLVLVVVIVFVVCWLPYHLFAISR 269
gi 229275329 233 --------------------------------------vqrnqsrrhreKAIKKVERLVAVVVTVFVICWLPFYIFQIAN 274
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|.
Feature 1                         ## ###  #  ##                     
4DKL_A       407 aliti-------pettfQTVSWHFCIALGYTNSCLNPVLYAFLDenFKRCF 450
gi 33860175  349 lsisr--------ptltFVYLYNAAISLGYANSCLNPFVYIVLCetFRKRL 391
gi 229291454 273 laglfey----indvdvESGIFHLVSALMYVNSCCNPLLYGYLDenIKRCI 319
gi 229281440 277 lateq-------qvtlwTLVVFHLAVFMSYANSCINPILYVFMSqkFRKSF 320
gi 229290295 284 livlp-------kmsktWLLLALTFNALSFTNSVINPILYSFLGeqFRQSF 327
gi 229290296 333 isigm-------dvslsVRQTALVVNLLAFCNSAINPLIYHCLGenFRKGF 376
gi 229297231 312 lvakl-------ppttlLMGVYNFILCLSYVNSCVNPFIYFLVSdsFRKNV 355
gi 61743877  267 lifil-------pedpvLVGVYFFVVVLSYANSCANPILYGFLSdnFKQSF 310
gi 229290294 270 llidpkvmfsdpktaniVQNVALSFNVLAFANSCVNPMLYSFLGknFRQSF 320
gi 229275329 275 lsnafs-----gmeldtAAGLFYFTITLSYANSCCNPVLYAFFDenFKKSF 320

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap