Conserved Protein Domain Family
7tmA_Anaphylatoxin_R-like

?
cd14974: 7tmA_Anaphylatoxin_R-like 
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors
This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.
Statistics
?
PSSM-Id: 320105
View PSSM: cd14974
Aligned: 17 rows
Threshold Bit Score: 287.275
Threshold Setting Gi: 20137533
Created: 23-Sep-2008
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:
  • Comment:based on the structures of some class A family members with bound ligands (peptides or chemicals), agonists, or antagonists
  • Comment:Small-molecule chemical ligands tend to bind deeper within the receptor core, compared to a peptide ligand neurotensin, which binds towards the extracelllular surface of its receptor.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               #  ##            ###### #
gi 37538305   24 ILSMVILSLTFLLGLPGNGLVLWVAGLKMQrtvNTIWFLHLTLADLLCCLS-LPFSLAHLalqgqwpygrflCKLIPSII 102
gi 47226483   39 LSLVVLNAIIFLLGFCGNALVIWIAGFKMKktvNTTWYLSLAVSDFVFCAF-LPFSIASMtmevwi-fgrvmCKLVPAVL 116
gi 296439334  33 HAAVLLHGLASLLGLVENGVILFVVGCRMRqtvVTTWVLHLALSDLLASAS-LPFFTYFLavghswelgttfCKLHSSIF 111
gi 185132402  38 SVETVINILISLLGLSGNAIVIWISGFKMRtsvNTTWYLSLAISDFLFCVC-LPFNIVYMvtshwp-fglvmCKLTSSAM 115
gi 17380487   41 IFLVVVYSIVCFLGILGNGLVIIIATFKMKktvNMVWFLNLAVADFLFNVF-LPIHITYAamdyhwvfgtamCKISNFLL 119
gi 130506314  49 VLLLVINMLICLLGLSGNGVVIWIAGFAMKksvNTTWYLSLAVSDFIFCAF-LPFNIAYSatsnwi-fglfmCKFTSFVM 126
gi 82592893   30 AIIAAALFMSFIVGTISNGLYLWMLKFKMQrtvNTLLFFHLILSYFISTLI-LPFMATSFlqdnhwafgsvlCKVFNSTL 108
gi 466000670  20 LVFMVLCTLTFILGVTGNGFIIFITRCQKKktvNAMWHLNMAIAGFIFTVF-LPLMVAQValgfnwylrsvlCKITNIII 98
gi 20137533   36 VAPLPLYAAIFLVGVPGNAMVAWVAGKVARrrvGATWLLHLAVADLLCCLS-LPILAVPIargghwpygavgCRALPSII 114
gi 466000644  20 HIAIGTNALVLGLGLAGNGLVIWITTVGWAgppTFPSACYLHLADLLFSAGrIPAIVQEAlrsrwp-fgralCKLHSFAR 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 37538305  103 VLNMFASVFLLTAISLDRCLVVFKPIWcqnhrnVGMACSICGCIWVVAFVMCIPVfvyreifttdnhnrcgykfglsssl 182
gi 47226483  117 FLNMFSSIFLLVVISVDRLVSVLFPVWtqnhrtVKKASVVVFLAWLLAVALSVPSfifrdvvthlgrt------------ 184
gi 296439334 112 FLNMFASGFLLSAISLDRCLQVVRPVWaqnhrtVAAAHKVCLVLWALAVLNTVPYfvfrdtisrldgrimcyy------- 184
gi 185132402 116 FLNMFSSVFLLVLISVDRCVSITFPVWaqnnrtIPRASGVVVLVWALSAALTVPSlvyrqtkthga-------------- 181
gi 17380487  120 IHNMFTSVFLLTIISSDRCISVLLPVWsqnhrsVRLAYMACMVIWVLAFFLSSPSlvfrdtanlhgkiscfnnfsl---- 195
gi 130506314 127 FLNMFSSIFILVIISVDRCVAVMFPVWaqnhrtIGKASVLIILAWIASAALSIPSivyrdvqnylgtn------------ 194
gi 82592893  109 SVSMFASVFFLSAISVDRYHLTLHPVWsqqhrtPRWASRIALRIWILATILSIPYlvfrethddhkgrikcqnn------ 182
gi 466000670  99 SLSMFSSSFHLTAISADHCVTTVCPVWaqnhctVHLASLVTLSIWILAVMVSWRYhglcsdqs----------------- 161
gi 20137533  115 LLTMYASVLLLAALSADLCFLALGPAWwstvqrACGVQVACGAAWTLALLLTVPSaiyrrlhqehfpar----------- 183
gi 466000644  99 YLVVFAGVFVLTLISLHRCLLVAQPVWvrnhcrPRLGCWLIAGAWFLAICFSVPYlvlrdvetrhges------------ 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 37538305  183 dypdfygdplenrslenivqppgemndrldpssfqtndhpwtvptvfqpqtfqrpsadslprgsarltsqnlysnvfkpa 262
gi 47226483      --------------------------------------------------------------------------------
gi 296439334     --------------------------------------------------------------------------------
gi 185132402     --------------------------------------------------------------------------------
gi 17380487      --------------------------------------------------------------------------------
gi 130506314     --------------------------------------------------------------------------------
gi 82592893      --------------------------------------------------------------------------------
gi 466000670     --------------------------------------------------------------------------------
gi 20137533      --------------------------------------------------------------------------------
gi 466000644     --------------------------------------------------------------------------------
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                              #  ### ###
gi 37538305  263 dvvspkipsgfpiedhetspldnsdaflsthlklfpsassnsfyeselpqgfqdyynlgqftdddqvptpLVAITITRLV 342
gi 47226483  185 ----------------------------------------------------------scvnkytfdrysHSIVAYSRLV 206
gi 296439334 185 ----------------------------------------------------nvlllnpgpdrdatcnsrQVALAVSKFL 212
gi 185132402 182 -----------------------------------------------------------dtlcytdyqsgHKAVALSRFV 202
gi 17380487  196 -------------------------------------------------stpgssswpthsqmdpvgysrHMVVTVTRFL 226
gi 130506314 195 ----------------------------------------------------------dcmnnytssrygHKVIAVSRFI 216
gi 82592893  183 ---------------------------------------------------yivgtnwessehqtlgqwiHAACFGRRFL 211
gi 466000670 162 ---------------------------------------------------------------lllresgEAANIAIQFL 178
gi 20137533  184 ---------------------------------------------------------lqcvvdyggssstENAVTAIRFL 206
gi 466000644 167 ----------------------------------------------------------fcvyrrdlrrfaEMPLRLSRFL 188
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ##                                            #  ## ##  #             ## ###  #
gi 37538305  343 VGFLLPSVIMIACYSFivfrmqrgrfaKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSlltdpe-tplgktLMSWDHVCI 421
gi 47226483  207 AGFVVPFAIIIICYSIiilkl-rknrmTKSSKPFKVMSALVVAFFVCWLPYHVFIMLElnhqn---lnhnlLVIGLKVGT 282
gi 296439334 213 LAFLVPLAIIASSHAAvslrl-qhrgrRRPGRFVRLVAAVVAAFALCWGPYHVFSLLEarahan-pglrplVWRGLPFVT 290
gi 185132402 203 CGFVIPLLIIVFCYSVifvql--rsrpMKSTKPVKVMTVLIVSFFVCWVPYHTFVLLEwnlgn---hslemLYTWLKVGS 277
gi 17380487  227 CGFLVPVLIITACYLTivckl-qrnrlAKTKKPFKIIVTIIITFFLCWCPYHTLNLLElhhta---mpgsvFSLGLPLAT 302
gi 130506314 217 FGFIIPFILIILCYTViivrl-raskmAKSNKPFKIMTALILTFFLCWLPYHTFVLIEfnqtf----engiIRLGMQIGT 291
gi 82592893  212 LGFLLPFLVIVFCYKRvatkm-kdkglFKSSKPFKVMLTAVVSFFVCWMPYHVHSGLVltks-----qplpSQLTLGLAV 285
gi 466000670 179 VGFLIPLALISICLVTlaarr-gqkrvAWSKKPLRTLLILHIIFFLCWSPYHIIAFLQtspkasspettesLETGTIFAH 257
gi 20137533  207 FGFLGPLVAVASCHSAll--------cWAARRCRPLGTAIVVGFFVCWAPYHLLGLVLtvaapn-sallarALRAEPLIV 277
gi 466000644 189 GGFLVPFAIIATSYVVltwkl-rrrswEGSRRTSALVLAVVALFFVCWLPHHILVLLSthqa-----nkevWGVALKLAN 262
                        410       420
                 ....*....|....*....|....*.
Feature 1          ##                      
gi 37538305  422 ALASANSCFNPFLYALLGk-dFRKKA 446
gi 47226483  283 LMAAANSFLNPMLYVFMGn-dFRQKF 307
gi 296439334 291 SLAFFNSVANPVLYVLTCp-dMLRKL 315
gi 185132402 278 TMAAVNSFLNPILYVLMGh-dFRQTL 302
gi 17380487  303 ALAIANSCMNPILYVFMGq-dFKKFK 327
gi 130506314 292 ITAAANSFLNPVLYVFMGn-dFRKRF 316
gi 82592893  286 VTISFNTVVSPILYLFTGe-nFEVFK 310
gi 466000670 258 GLLCFNSCFYPFFYLITRq-hFVSCR 282
gi 20137533  278 GLALAHSCLNPMLFLYFGraqLRRSL 303
gi 466000644 263 ALAYLHSCLNPVLYGLVGyarSRGRR 288

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap