4GRV,3ZEV


Conserved Protein Domain Family
7tmA_NTSR-like

?
cd14979: 7tmA_NTSR-like 
Click on image for an interactive view with Cn3D
neurotensin receptors and related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors
This subfamily includes the neurotensin receptors and related G-protein coupled receptors, including neuromedin U receptors, growth hormone secretagogue receptor, motilin receptor, the putative GPR39 and the capa receptors from insects. These receptors all bind peptide hormones with diverse physiological effects. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320110
View PSSM: cd14979
Aligned: 9 rows
Threshold Bit Score: 342.027
Threshold Setting Gi: 409107331
Created: 29-Sep-2008
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:peptide ligand binding site [polypeptide binding site]
Evidence:
  • Structure:4GRV: Rattus norvegicus neurotensin receptor Nts1 binds neurotensin peptide (8-13), contacts at 4A.
    View structure with Cn3D
  • Structure:3ZEV: Rattus norvegicus neurotensin receptor 1 binds agonist neurotensin, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                       #                
4GRV_A        33 VLVTAIYLALFVVGTVGNSVTLFTLARKKSlqslqstVHYHLGSLALSDLLILLLaMPVELYNFiwvhhpWAFGda--gC 110
3ZEV_A        20 VLVTAIYLALFVVGTVGNSVTLFTLARKKSlqslqstVDYYLGSLALSDLLILLLaMPVELYNFiwvhhpWAFGda--gC 97
gi 121583867  30 ITLALLDICIFVAGILGNSITIKATRILQKkgylqkeVTDHMVSLACSDLLVILLgMPVEFFSAiw--kpFATPngnvaC 107
gi 90111819   69 VLITIIFGGIFITGVVGNLLVCIVIIRHSAmh---taTNYYLFSLAVSDLLYLLFgLPTEVFLYwhq-ypDLFGmp--fC 142
gi 74761608   61 MPICATYLLIFVVGAVGNGLTCLVILRHKAmr---tpTNYYLFSLAVSDLLVLLVgLPLELYEMwhn-ypFLLGvg--gC 134
gi 3023860    43 AGVTATCVALFVVGISGNLLTMLVVSRFRElr---ttTNLYLSSMAFSDLLIFLC-MPLDLVRLwqy-rpWNFGdl--lC 115
gi 453232830  52 YKVTALYIFIFLVGVIGNTTTCLVMKKHPMmk---thASMYLMNLAVSDLVTLCVgLPFEVMMNwnq-ypWPFPdy--iC 125
gi 229295106  27 VPLTIVYVITFMTGITGNVLTMIIFTTVPSlr---npTNFYLLSLAFSDLLMLVInLPVDMTEQlyq-ksWVLGdt--vC 100
gi 71986634   76 PILTLIFVFVGLVGLIGNLLTVIVIFKTNSlh---shTNYFLANLATSDFCLIVVgVSFDLVNIwn--deEPLDif-gyC 149
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #                                                              #             
4GRV_A       111 RGYYFLRDACTYATALNVASLSVARYLAICHPf-kAKTLMsRSRTKKFISAIWLASALLAIPMLFTMglqnrsa------ 183
3ZEV_A        98 RGYYFLRDACTYATALNVVSLSVELYLAICHPf-kAKTLMsRSRTKKFISAIWLASALLAIPMLFTMglqnlsg------ 170
gi 121583867 108 KLYYFLFEACSYATVLHVATLSFERYVAICHPf-kFKAVSgPRKVKILIAFVWGTSVIVALPLLFAMgteypleiienyq 186
gi 90111819  143 KIRAFISEACTYVSVFTIVAFSMERFLAICHPl-hLYAMVgFKRAIRIITALWIVSFISAIPFGLLSdiqylnypl---- 217
gi 74761608  135 YFRTLLFEMVCLASVLNVTALSVERYVAVVHPl-qARSMVtRAHVRRVLGAVWGLAMLCSLPNTSLHgirqlhvp----- 208
gi 3023860   116 KLFQFVSESCTYATVLTITALSVERYFAICFPl-rAKVVVtKGRVKLVILVIWAVAFCSAGPIFVLVgveheng------ 188
gi 453232830 126 NLKALIAETTSSVSILTILIFAIERYVAVCHPlflMKVQPfKRNIGTIIGFTWIFSILCAMPFAIHHradyimkswpg-- 203
gi 229295106 101 RSHVFMNELCYSATVMSICTLSIERYIAICHPl-qAKTLVtKERTMTAIVAVWLLSIAFSLPVSLWIqevsfrl------ 173
gi 71986634  150 SLTSTFISLFTFASILTIVLLTAERFTAICYPf-sHRTIFdEKRVKRFILLIWFVALLPSIFIGSMFkrvsqdfcg---- 224
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                              ####                                                      
4GRV_A       184 --------------dgthpggLVCTPivd-----tatVKVVIQVNTFMSFLFPMLVISILNTVIANKltvmvnifemlri 244
3ZEV_A       171 --------------dgthpggLVCTPivd-----tatLKVVIQVNTFMSFLFPMLVASILNTVIANKltvmvhqaaeq-- 229
gi 121583867 187 gvtacakstarhhlpelkqnmTICTSls--------sKWPVFQASIFSAFAVYIIVLGSVAFMCRSMmktlmihkkgtva 258
gi 90111819  218 -------------dhsrieesAFCSMspk-----ivnEIPVFEVSFCIFFVIPMILIILLYGRMGAKirsrtnqklgvq- 278
gi 74761608  209 -------------crgpvpdsAVCMLvrp-----ralYNMVVQTTALLFFCLPMAIMSVLYLLIGLRlrrerlllmqeak 270
gi 3023860   189 ---------------tdprdtNECRAtefa---vrsgLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKlwrrrgda----- 245
gi 453232830 204 -----------tdnripvkssKMCMIavmfepklastFKILFHFSAIAFFALPLFTIVILYARIACKvssnrtiq----- 267
gi 229295106 174 --------------psgesvwAKCTIplqy----qeqVQYFTAVATVVFFVVPMCLLAGLYLLIGVKlhktrsnpksrrg 235
gi 71986634  225 -------------fnrqmtyiGRCDLvtsp----dsfFRYPFESAITITFVLPLFFIIYCYFRILVTlnemsnsthvhtp 287
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4GRV_A       245 deglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvyd 324
3ZEV_A           --------------------------------------------------------------------------------
gi 121583867 259 vkge---------------------------------------------------------------------------- 262
gi 90111819      --------------------------------------------------------------------------------
gi 74761608  271 grg----------------------------------------------------------------------------- 273
gi 3023860       --------------------------------------------------------------------------------
gi 453232830     --------------------------------------------------------------------------------
gi 229295106     --------------------------------------------------------------------------------
gi 71986634  288 vgtarsdsgafpfp------------------------------------------------------------------ 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4GRV_A       325 sldavrraalinmvfqmgetgvagftnslrmlnnkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdaygsgsvQAL 404
3ZEV_A       230 -------------------------------------------------------------------grvctepgrvQAL 242
gi 121583867 263 ------------------------------------------------------------pgqqeqylrksessegkSSR 282
gi 90111819  279 -----------------------------------------------------------------qgtnnretrnsqMRK 293
gi 74761608  274 -------------------------------------------------------------saaarsrytcrlqqhdRGR 292
gi 3023860   246 ---------------------------------------------------------------------avgaslrdQNH 256
gi 453232830 268 ---------------------------------------------------------------------pgelditeELQ 278
gi 229295106 236 -----------------------------------------------------------------gklgrradalinKTR 250
gi 71986634  302 ---------------------------------------------------htsnnsntqsfpltvhtknvqpprsqQAQ 330
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
Feature 1                               ##  ##              #   #                             
4GRV_A       405 RHGVLVARAVVIAFVVCWLPYHVRRLMFCyisdeqwttflfdfYHYFYMLTNALAYASSAINPILYNLVSanFRQVF 481
3ZEV_A       243 RRGVLVLRAVVIAFVVCWLPYHVRRLMFCyisdeqwttflfdfYHYFYMLTNALVYVSAAINPILYNLVSanFRQVF 319
gi 121583867 283 RQIILFLGLIVATLAICWMPNQIRRIMAAakpkqdwtvpyfraYIILLPIADIFFYLSSVVNPLLYNISSqqFRSVF 359
gi 90111819  294 KTVIRMLAAVVITFFVCWFPFHLQRLIFLyaknmd---nyldiNEALFSIAGFAYYVSCTVNPIVYSVMSrrYRVAF 367
gi 74761608  293 RQVTKMLFVLVVVFGICWAPFHADRVMWSvvsqwt--dglhlaFQHVHVISGIFFYLGSAANPVLYSLMSsrFRETF 367
gi 3023860   257 KQTVKMLAVVVFAFILCWLPFHVGRYLFSksfepgs-leiaqiSQYCNLVSFVLFYLSAAINPILYNIMSkkYRVAV 332
gi 453232830 279 MRINAILCAIVSAFFICYLPFQLQRLLFFyfdnev---iltwvNQYMYFISGFLFYLATIINPIAYNLASsrFRRAF 352
gi 229295106 251 GQAVKKLGLVVLAFAVCWTPYHALRLMYVyadmfg--stekvvYLNMDYVSTVLLYLNSALNPVLYNLASkrFRHEF 325
gi 71986634  331 KMVIKMLVTVTAVFFVCYLPYHAQRLIVKynskdc---snsdfCKLLYPIAGILQYISASLNPIFYNLMSvrFRNGF 404

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap