4PHU


Conserved Protein Domain Family
7tmA_FFAR

?
cd14983: 7tmA_FFAR 
Click on image for an interactive view with Cn3D
free fatty acid receptors, member of the class A family of seven-transmembrane G protein-coupled receptors
This subfamily includes the free fatty acid receptors (FFARs) which bind free fatty acids (FFAs). They belong to the class A G-protein coupled receptors and are composed of three members, each encoded by a separate gene (FFAR1, FFAR2, and FFAR3). These genes and a fourth pseudogene, GPR42, are localized together on chromosome 19. FFAR1 is a receptor for medium- and long-chain FFAs, whereas FFAR2 and FFAR3 are receptors for short chain FFAs (SCFAs), which have different ligand affinities. FFAR1 directly mediates FFA stimulation of glucose-stimulated insulin secretion and also indirectly increases insulin secretion by enhancing the release of incretin. FFAR2 activation by SCFA suppresses adipose insulin signaling, which leads to the inhibition of fat accumulation in adipose tissue. FAAR3 is expressed in intestinal L cells, which produces glucagon-like peptide 1 (GLP-1) and peptide YY (PYY), suggesting that this receptor may be involved in energy homeostasis. FFARs are considered important components of the body's nutrient sensing mechanism, and therefore, these receptors are potential therapeutic targets for the treatment of metabolic disorders, such as type 2 diabetes and obesity.
Statistics
?
PSSM-Id: 320114
View PSSM: cd14983
Aligned: 6 rows
Threshold Bit Score: 300.504
Threshold Setting Gi: 665764643
Created: 29-Sep-2008
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 41 residues -Click on image for an interactive view with Cn3D
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                 #  ##            ######
4PHU_A        19 QLSFGLYVAAFALGFPLNVLAIRGATAHARlr-ltPSAVYALNLGCSDLLLTVSLPLKAVEALasgaWPLPaslCPVFAV 97
gi 3122160     8 SLILMAYIIIFLTGLPANLLALRAFVGRIRqpqpaPVHILLLSLTLADLLLLLLLPFKIIEAAsnfrWYLPkvvCALTSF 87
gi 465952213   6 TLALAVYFVTILLGLPANTLALYIFYRRARar-ltPNLIYMINLCLSDLAFILILPLKILEVVpp-gWSPAnflCSLYSL 83
gi 557022134   4 ILYLMVYCSTIALGLPSNLLALYALYNTARnk-mtPNVIYMMNLCISDLVFIMMLPIKILETIet-qWILPavfCPVYNL 81
gi 512889217   5 NLLLAVYVLTIFLGLPSNIMVLYLFFKEARsr-ltPNLIYMINLCVSDLVFIMVLPIKIIEIFss-tWTLPqilCPLYNL 82
gi 573907980  11 YLFLTVYSLTLLLGLPSNILVLAAFVNKARtegttPNVVYVINLCLANLVFVLWLPIKIVETLk--sWTLPallCPIYNF 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ##  #                                            # #####                       
4PHU_A        98 AHFAPLYAGGGFLAALSAARYLGAAFPlgYQAFRRpCYSWGVCAAIWALVLCHLGLVFGleapggwldhsntslgintpv 177
gi 3122160    88 GFYSSIYCSTWLLAGISIERYLGVAFPvqYKLSRRpLYGVIAALVAWVMSFGHCTIVIIvqylntte---------qvrs 158
gi 465952213  84 AHFGTLYASTCFLTAVSAGRYLGTTFPirYQLYKKpLYSCLVCVAIWILVGFHGVLLLIletslgan--------atlft 155
gi 557022134  82 LHFSTLYASTTFLTAISAGRYLSVAFPikYQLRKKpKYSCWICAILWLLVVVHVTLVFLlenivitsnnstgityfistm 161
gi 512889217  83 IHFSTIYASVCFLSAVSVGRYLSTAFPikYNIYKKpRYSCLVCVILWVIVIFHMAFVFLvetsqngsia-----lfltnh 157
gi 573907980  89 FHFSTIYASTLFLTSISVGRYLSIAFPisYKLYKKaKNSCFVCVFFWAIVITHVALVLTvqendedlf-------isssa 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                         #  ### ### ##                                                  
4PHU_A       178 ngsPVCLEAWdp---asAGPARFSLSLLLFFLPLAITAFCFVGCLRAlargsnifemlrideglrlkiykdtegyytigi 254
gi 3122160   159 gneITCYENFtdnqldvVLPVRLELCLVLFFIPMAVTIFCYWRFVWImlsqp---------------------------- 210
gi 465952213 156 gngSTCYQEFspeqlalLAPVRLELSVALFFLPLAITVFCYASCIHVlvks----------------------------- 206
gi 557022134 162 gnsSVCYDNFteqqldlLAPVRLEISIVLFFLPLILTAFCYLRCIRIlirt----------------------------- 212
gi 512889217 158 dntWLCYENFtseqlalVVPVRFEISIVLYFFPLAITLFCYVSCIRIlmrs----------------------------- 208
gi 573907980 162 dntSTCYNNFtkeqldfLAPLRLEMAVVLFFIPLLVTSFCYFRCIALvvrs----------------------------- 212
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4PHU_A       255 ghlltkspslnaakseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmget 334
gi 3122160       --------------------------------------------------------------------------------
gi 465952213     --------------------------------------------------------------------------------
gi 557022134     --------------------------------------------------------------------------------
gi 512889217     --------------------------------------------------------------------------------
gi 573907980     --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                     #  
4PHU_A       335 gvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdaygslthRRKLRAAWVAGGALLTLLLCVGP 414
gi 3122160   211 -----------------------------------------------------lvgaQRRRRAVGLAVVTLLNFLVCFGP 237
gi 465952213 207 -----------------------------------------------------rlheQKKRRAVRLAMAPLSIFVLCFGP 233
gi 557022134 213 -----------------------------------------------------klseRKKKRAIALAMSTLATFVMCFAP 239
gi 512889217 209 -----------------------------------------------------rmhvNLKRKAMRVAVTTLVVFIVCFAP 235
gi 573907980 213 -----------------------------------------------------clhtRRKRRVIRVAVSTLIVFVVCFAP 239
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|
Feature 1        ## ##  #      ## ###  #  ##                       
4PHU_A       415 YNASNVASFlypnlGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVC 464
gi 3122160   238 YNVSHLVGYhq-rkSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGR 286
gi 465952213 234 YNLSHVVGYar-seDVWWRRVALLPGACNAFLDPLIFYFLSSAKDYGLAW 282
gi 557022134 240 YNISHVVGFvl-hqNLWWRKLALLCTTCNAFLDPFIFFFLSSTMERTFHQ 288
gi 512889217 236 YNISHVVGFvi-heSVWWRKWALLPSTCNAFLDPLIFYFISSSMDQGFYH 284
gi 573907980 240 YNFSHVVGFir-heNVEWRGEALLTSTCNVFLEPIIMFFLSSSTEHRLNH 288

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap