Conserved Protein Domain Family
7tmA_Trissin_R

?
cd15012: 7tmA_Trissin_R 
trissin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This subgroup represents the Drosophila melanogaster trissin receptor and closely related invertebrate proteins which are a member of the class A family of seven-transmembrane G-protein coupled receptors. The cysteine-rich trissin has been shown to be an endogenous ligand for the orphan CG34381 in Drosophila melanogaster. Trissin is a peptide composed of 28 amino acids with three intrachain disulfide bonds with no significant structural similarities to known endogenous peptides. Cysteine-rich peptides are known to have antimicrobial or toxicant activities, although frequently their mechanism of action is poorly understood. Since the expression of trissin and its receptor is reported to predominantly localize to the brain and thoracicoabdominal ganglion, trissin is predicted to behave as a neuropeptide. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320140
View PSSM: cd15012
Aligned: 6 rows
Threshold Bit Score: 347.894
Threshold Setting Gi: 392891031
Created: 9-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative peptide ligand binding pocket [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               #  ##              ######
gi 161076720 186 IFITLYTLVFCCCFFGNLLVILVVTLSRRLRsiTNFFLANLAFADFCVGLFCVMQNLSIYLies---wvfGEFLCRMYQF 262
gi 443684415  35 LFIILYSIVFICAFIGNILVITVVLKHRRMRtiTNFFLANLAVADLAVGIFCVLPNLSVNLspn---wflGRTMCKLYYF 111
gi 215498217  53 ILAIAYTLVFCCCFFGNLLVICVVILNRRMRtiTNFFLTNLAVADLCVSMFCVYQNLFFYLtph---wvfGDFLCRMYFF 129
gi 71997037   15 LLCVSYLFVFLATIIGNLIILLVFFSQKRVRsvPNFFLANLTVADLFVGIFCVLQNAVNFVfqghgrwpfGKVLCYSYIY 94
gi 392891031  32 PVMIIYCLVFVVCLSGNFLTLIVMTSHPMMRtpTNFFLSNLAIADLLVAIFCILQNMIHIVgfdhgnwplGPVMCKLYLG 111
gi 442626224 186 IFITLYTLVFCCCFFGNLLVILVVTLSRRLRsiTNFFLANLAFADFCVGLFCVMQNLSIYLies---wvfGEFLCRMYQF 262
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ##  #                                            # #####                       
gi 161076720 263 VHSLSYTASIFILVVICMERYFAIVHPItckqiltaaRLRMVIVTVWITSAVYSTPKFVFsktiknihtqdgq---eeei 339
gi 443684415 112 VQAMSYTASITILTVISIERYVAIIYPLrakqlttmcLLRVTVLLIWLISAASGIPFLIVydqvsilvpacvstppsvmn 191
gi 215498217 130 VHGLSYTTSILILTVICVERYIAIVHPMwnkqvvtltRLRVTIVTVWFVSAAYCSPRIIMygtveatvddkr-----eal 204
gi 71997037   95 VLHFIPNVSAGILVLVSVERLIAVLRPLrvrrafsqkVLITSSAVVWLTSAVMNTPYVVAsqfleisdgnetyt-ictrr 173
gi 392891031 112 LTNIMPCTSAGILVLVSLEKYIAVLHPLsglklltpeHRWVATMIVWVISILVNFPYFLYaqnytylg------------ 179
gi 442626224 263 VHSLSYTASIFILVVICMERYFAIVHPItckqiltaaRLRMVIVTVWITSAVYSTPKFVFsktiknihtqdgq---eeei 339
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #  ### ### ##                                                          
gi 161076720 340 cvldremfnSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRSSRGltphvvqhqhqqpqqpscqdigmgmhnsmyhhhp 419
gi 443684415 192 fcmpihdinMRAYNTSNFLIWFLIPLCLMTTLYVHISVVLWKSSSQspqsglrthnprqmhaynasdtkqha-------- 263
gi 215498217 205 cvlqralydSMTYDLVNFVVCFLVPLIIITVLYTIICYELWHSQAIvshpqnhmsktsnnhhppahgggattpalcrscs 284
gi 71997037  174 hveiygfnlLKLVATINFIVWYAVPLVILLCIYATIGLVVSKAATItkhsankllprss--------------------- 232
gi 392891031 180 -vsacfrgsMPIWNSFSFIVWYLIPLTALVFIYSRISHLLWTSDSNrqssrqshesngslergngyantaqpgsswqm-- 256
gi 442626224 340 cvldremfnSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRSSRGltphvvqhqhqqpqqpscqdigmgmhnsmyhhhp 419
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 161076720 420 hhhhhhhqhhqlqsaassagvvgvglgggggggpgpslasggssttslsrkqsskyekrgvsitesqldnckvsleadrp 499
gi 443684415     --------------------------------------------------------------------------------
gi 215498217 285 esesppsvkkleyaqtlvttkkspkd-------------------------------------------ltstetrtvpy 321
gi 71997037      --------------------------------------------------------------------------------
gi 392891031     --------------------------------------------------------------------------------
gi 442626224 420 hhhhhhhqhhqlqsaassagvvgvglgggggggpgpslasggsst-----tslsrkqsskyekrgvsitesqvsleadrp 494
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                            #  ## ##  # 
gi 161076720 500 ivsacrktsfyhhghahhqragnasvgggsggagagathmshsssnvlRARRGVVRMLIIFVLTFALCNLPYHARKMWQy 579
gi 443684415 264 ----------------------spsaplksrcngkpqqkshnkpenalLARRKVIRLLIAVLMSFTLCVLPYYVWKMWQm 321
gi 215498217 322 ltpgqgydegtqlsresscnrcsrvstpprkqatkpfhyvnnaamsalKPRRKVIRLLVAVVLCFAVCNLPFHARKLWQh 401
gi 71997037  233 ------------------------------------wrseastggvsvEKRRKVGRLAVGIVVAFAFFSLPRYVYFMWTv 276
gi 392891031 257 ----------------kngrivvykqesllnvpkrekkvkepkrpkdtEGRRKVVRLLVAVVVSFALLTFPHHARLLYTs 320
gi 442626224 495 ivsacrktsfyhhghahhqragnasvgggsggagagathmshsssnvlRARRGVVRMLIIFVLTFALCNLPYHARKMWQy 574
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*..
Feature 1                     ## ###  #  ##                     
gi 161076720 580 wsrsy--rgdsnfNALLTPLTFLVTYFNSGVNPLLYAFLSrNFRKGM 624
gi 443684415 322 wtep----sfnnwELLLTPITFVIFYLNSALNPLLYAFLSdKFRQSL 364
gi 215498217 402 skeyn---gsstaAAILTVVTNLVLYLNSGINPFLYALFSkNFRQCM 445
gi 71997037  277 wrdpmaprclnclQSVLQPISFLLLFFNAAVDPFLYAFLStRFRQSI 323
gi 392891031 321 fqtgt--icnsnwTMIFQPLSYIFLFISSAINPILYACLSkRFRNAL 365
gi 442626224 575 wsrsy--rgdsnfNALLTPLTFLVTYFNSGVNPLLYAFLSrNFRKGM 619

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap