Conserved Protein Domain Family
7tmF_FZD3_insect

?
cd15031: 7tmF_FZD3_insect 
class F insect frizzled subfamily 3, member of 7-transmembrane G protein-coupled receptors
This group represents subfamily 3 of the frizzled (FZD) family of seven transmembrane-spanning G protein-coupled proteins that is found in insects such as Drosophila melanogaster. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.
Statistics
?
PSSM-Id: 320159
View PSSM: cd15031
Aligned: 11 rows
Threshold Bit Score: 287.051
Threshold Setting Gi: 357625301
Created: 14-Nov-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence similarity to Human smoothened receptor bound to an antitumor agent.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #        #                                                 #                   
gi 20454884  225 AFHTSSQKKTSETLILGLSAVCFVLTLFALVTFWAEPTrFGYPERPVLFLCLCYNLFSVCYLERIVFh---------NQA 295
gi 193906743 262 AFHSTQQKKLTESLVLGLSAVCFVLTLFALVTFWAEPTrFGYPERPVLFLCLCYNLFSVCYLERIVF----------HQA 331
gi 190618699 238 AFHTTAQKKLTESLILGLSAVCFVLTLFALVTFWAEPTrFGYPERPVLFLCLCYNLFSVCYLERIVFh---------NQA 308
gi 198145867 266 AYHTTQQKKLTESLILGLSAVCFVLTLFALVTFWAEPTrFGYPERPVLFLCLCYNLFSVCYLERIVFh---------NQA 336
gi 194149469 252 AFHTTQQKKLTESLILGLSAVCFVLTLFALVTFWAEPTrFGYPERPVLFLCLCYNLFSVCYLERIVF----------HQA 321
gi 194160381 268 AFHTSQQKKLTESFILGLSAICFVLTLFALVTFWAEPRrFGYPERPVLFLCLCYNLFSICYLERIVFh---------NQS 338
gi 333467266 137 ALYSQRQKELVELWTLVLSAVCFIFTLTSLVSFWAKASkLEYPDRPILFMTLCYNLLGLCYLERTIL----------HSP 206
gi 167863770 171 AMYTGRQKETVEFWTLILSAGCFIFTLMSLVTFWTKATkFEYPDRPLLFMTLCYNLMGLCYLERTIL----------HNP 240
gi 308194295  45 AFFSQEQVDILHYSNLVLSCLSIITGCIILFLYLINYCkIKHPEAPIYYIAGLQLVISTMQLISGLYgtfnsmsstnSSS 124
gi 357625301 128 ARYTEGNKKIAEIWMITLAWFSLLSTSFALLTFCAEPSrYRYPERPVVWMAACHAIVALSHVTRGWLgak----aasCSG 203
gi 313240733 204 MVKETRDVTLVRMVMAVFCVVSAMISSFSIIIFLKDRKrFVYPERPTLYFALCYFIISITVLATLISpee-----saCAA 278
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 20454884  296 RMHDVelqgrl---------------mrpgclLTPPCLASYITTSYLSLCAASWWLIFALCFYLSSHKKWSsEALEKRSG 360
gi 193906743 332 RSLALlqepggr-------------agraacaLTPPCLASYISTSYLSLCAASWWLIFALCFYLSSHKKWSsEALEKRSG 398
gi 190618699 309 RSLAAqmqdvpr--------------lrqgclLTPPCLASYITTSYLSLCAASWWLIFALCFYLSSHKKWSsEALEKRSG 374
gi 198145867 337 RSLAQlqepqgl-------------rlrpacqLTPPCLASYITTSYLSLCAASWWLIFALCFYLSSHKKWSsEALEKRSG 403
gi 194149469 322 RSLALlqqqqepg-----------rvgrapcaLTPPCLASYISTSYLSLCAASWWLIFALCFYLSSHKKWSsEALEKRSG 390
gi 194160381 339 RSRAIyepis-----------------tvctlLSPPCLASYISTSYLSLCAATWWLIFALCFYLSSHKKWSsEALEKHSG 401
gi 333467266 207 RRLEAavelmlldapghhpsaatathlrsdctITSQCLAYYILKHYLLLSASTWWLIFGLCWYLSTAKQWScEALERKSG 286
gi 167863770 241 RKELIdlmef-----------------rqdctITSQCLAYYIIKNYLLISATMWWLIFGVCWYLSTAKQWScEALEKKSG 303
gi 308194295 125 DSEGLhcddryknhf-------nesillqdggDNPFCLTIFAILYYSFLSILSWWTVITIEWLVTSIKRKQ-TKKKYLYI 196
gi 357625301 204 ATLAVdg------------------------lASPTCVAFFSLTYYFTLAADAWFANACVAWYLTAASEWStEALERAAA 259
gi 313240733 279 ADSGIsalf--------------------sgwKSSQCIATFSIVFFFQVAATMWWLVLVLIWGLSLVLDLNlDVIESKGR 338
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                 #    # #  ##                    #                      
gi 20454884  361 LFHVLAWVPPLAPPIAALLLEKVRPSELTGMCYAPGFv----------------ELPALVLLLLGLYFTLRASRSLLSLQ 424
gi 193906743 399 LFHVLAWVPPLAPPIAALLLERVRPSELTGMCTAPGFv----------------ELPALALLLLGLYFTLRASRSLHSLQ 462
gi 190618699 375 LFHVLAWVPPLAPPIAALLLERVRPSELTGMCTAPGFv----------------ELPALVLLLLGLYFTLRASRSLLSLQ 438
gi 198145867 404 LFHVLAWVPPLVPPIAALLLERVRPSELTGMCSAPGFv----------------ELPALVLLLLGLYFTLRASRSLHSLQ 467
gi 194149469 391 LFHVLAWVPPLAPPIAALLLERVRPSELTGMCTAPGFv----------------ELPALALLLLGLYFTLRASRSLHTLQ 454
gi 194160381 402 LFHVLAWVPPLAPPIAALLLEKVHPSELTGMCMAPGFv----------------EVPALILLLLGLYFTLRASRSLHSLQ 465
gi 333467266 287 LFHVLAWVVPFAAPIGALLRGHIQRFELTGFCNARGFt----------------ELPVLLLLLLGTALVSCALAALARLR 350
gi 167863770 304 LFHVMAWVVPFASPISALLRGNIQKFELTNFCTAKGFt----------------EIPALILLLVGAVLIFLALVALKRLK 367
gi 308194295 197 ISHIAGWSIPIPFLFTAAYLNAVSGSTTEMTCWISRRnesqyqlafiiiplsisLTFNSILLLLGFWINCKKGRHRNSLY 276
gi 357625301 260 YLHAVAWGWAGAWTAAALALRRVTADELTGTCGISDTaaa-----------aliGVPRGALLLTSIALAIAACPGIMRVR 328
gi 313240733 339 ILHLFAWTPALALTTIAVLQKRISADPFLGICALDGDlssf---------yffsLLPLVTLTLIGLITFIAGLKKLLCVS 409
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                         ##             
gi 20454884  425 QQLQPTLAHHRFgq--iRKRFVLFSLLYFAPTTAGVVAALCERYADSVPSCSTPd--------dCLSP-----------T 483
gi 193906743 463 QQLQPTLAHQRFaq--iRKRFVIFSLLFFVPTAAGVVAAFCERYVEAVPSCATPe--------dCVQP-----------A 521
gi 190618699 439 QQLQPTLALAHHrfgqiRKRFVLFSLLYFAPTAAGVIAALCERYVDSVPGCSTPe--------dCASP-----------A 499
gi 198145867 468 QQLQPTLAHHRFgq--iRKRFVIFSLLFFVPTAAGVVAALCERFGDPVPSCSTLe--------dCASP-----------E 526
gi 194149469 455 QQLQPTLALAHQrfaqiRKRFVVFSLLFFLPTAAGVVAAFCERYVDAVPSCSTLe--------dCAPP-----------A 515
gi 194160381 466 QQHQLHLQHQQRfs-qlRKRFVIFSLLFFIPTAAGLMLGAFYRDLGGAPPTIVPscst---ledCSPP-----------D 530
gi 333467266 351 HCWNQRAPHLGRv----FGRVLLFAVCYLLPALSATVCMMLERVDHELEPCPAGgep----gdgCVHRv---------qP 413
gi 167863770 368 STWNQSETLSKV-----FTRVLLFAIIYLIPALSALICTFFERIENPVEPCNSNt--------iCAPP-----------P 423
gi 308194295 277 LSSRNEEVTTPQ-----LARVSIYSVLQLVVMGLLLMCYLHQYWYQRDAEINYLqfivhkhvssCYPHat-------dnH 344
gi 357625301 329 RALDSRGAKRVGr---lAARAAAGGLLYLLLAAFATGTKVIEAKNREAQTNLAL----------LAALea-------giV 388
gi 313240733 410 SDFGSVFTSAPKle-qfLFRISAFSCCFLIPKIAEEILKMSFSSLTPLLESTWYhe-------nCASLgvpcplgvspnE 481
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
Feature 1         #    #  ##                             
gi 20454884  484 PLSAWPALVRIFFQLVGGTLTGLWVWSRK-TCESYRNRLG 522
gi 193906743 522 QLSAWPALVRIFFQLVGGTLTGMWVWSRK-TCESYRSRLV 560
gi 190618699 500 PLSAWPALVRIFFQLVGGTLTGLWVWSRK-TCESYRSRLG 538
gi 198145867 527 PLTAWPALVRIFFQLAGGTLTGMWVWSRK-TCESYRSRLV 565
gi 194149469 516 QLSAWPALVRIFFQLVGGTLTGMWVWSRK-TCESYRSRLV 554
gi 194160381 531 KLSAWPSLMRVFFQLLGGTLTGLWVWSRK-TCENYRSRLV 569
gi 333467266 414 HFSLLPTVLRLALTLLGGGSVGVWLWSRQpSDTELGPGGK 453
gi 167863770 424 KFSILPTLLKLILTLVGGSTTGIWLWSKQsTDLNKKSSLV 463
gi 308194295 345 FMFFITAILRVLCFQIMGVVLLLWILRRElLCTCRYRCKY 384
gi 357625301 389 KDTAGSSGVSVCLWLSCGIAAGAWAWSRK-STVVWRKALC 427
gi 313240733 482 FIEPLIMLLRYVFFIIPSWAPMVWLANGK-SLRAWGINSD 520

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap