Conserved Protein Domain Family
7tmA_Histamine_H3R_H4R

?
cd15048: 7tmA_Histamine_H3R_H4R 
histamine receptor subtypes H3R and H4R, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes histamine subtypes H3R and H4R, members of the histamine receptor family, which belong to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H3 and H4 receptors couple to the G(i)-proteins, which leading to the inhibition of cAMP formation. The H3R receptor functions as a presynaptic autoreceptors controlling histamine release and synthesis. The H4R plays an important role in histamine-mediated chemotaxis in mast cells and eosinophils. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320176
View PSSM: cd15048
Aligned: 16 rows
Threshold Bit Score: 346.598
Threshold Setting Gi: 291233961
Created: 13-Nov-2008
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                     #  
gi 17366878   36 AVLAALMALLIVATVLGNALVMLAFVADSSlr-tqNNFFLLNLAISDFLVGVFCIPLYVPYVLtg-rWTFGrglCKLWLV 113
gi 390344266  27 AIVPLIISLISSVTVIGNLMVIVAFIRDHCirfkvANLFILNLAITDFIVGAFMWPVNISWLIkd-eWVHGeivCKVWLI 105
gi 291233961  74 IFLGVLLSVIVLITIIGNFMVILAFITDVKlrryiGNFFLLNLAVSDFIIGLVSLPLNTAWFLsg-nWLLGevvCKIWIV 152
gi 118403355   7 IVLNTFFGCISAVTIVGNLLAIAVFVKDGKlr-stGDVYILNLAVADLMVGAISMPFTIAENVig-yWPLSqtfCKAWLL 84
gi 443693870   3 VVLLLLFIAIGLTNIIGNTITLIAFVKDSKlq-qvSNFYIFNLAIADLLVGLSSVPVYAVYTLsnyhWGMGnvaCKIWLF 81
gi 405962108  66 VPLGVLLAVLVVLAVSGNALTIIAFARDKSlr-tvYNMYLVNLAVTDFCLGLFSMLFYSVHTLasynWPFGyhfCKAFLV 144
gi 443718157  28 VAMTIVISIMIGINVVGNCCTIIAFRSDAKlr-tfSNFYIFNLAVTDLFIGFVSLPFYTAYTLmnytWPFGrvfCKIYNL 106
gi 405962107  23 IPCGIIIVCLIFFAVFGNLMTIAAFIRDKGlr-nvYNMYLINLAVTDLLLGLVSMPFYAVYTLkshsWPFGyhfCKTYMV 101
gi 14194819   16 VTLAFFMSLVAFAIMLGNALVILAFVVDKNlr-hrSSYFFLNLAISDFFVGVISIPLYIPHTLf--eWDFGkeiCVFWLT 92
gi 443693053  28 ITVAMVILIMVSINIVGNSCTIVAFCSDAKlr-tlSNYYIFNLAVTDLVIGFVSLPFYAVYTLmnytWPFGrifCKVFNI 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ##  ##                                                                        #
gi 17366878  114 VDYLLCTSSVFNIVLISYDRFLSVTRAv-sYRAQQgdTRRAVRKMVLVWVLAFLLYGPAilsweyls-ggssipegHCYA 191
gi 390344266 106 VDYTITMMSALTLVMISWNRYCVLSMGi-kYQAFQt-KKRVGLILFSTWTAVLLWYSFLafawspltgqysvdytyNCEL 183
gi 291233961 153 MDFTACYASVCAIVLISLDRYWLVSKNd--YFVFQt-NRKVACMCAASWVFSLLLYLPVeigwtaftgernidyteSCEI 229
gi 118403355  85 VDFTACSESVLSMVLISFDRYLQIVKPh-kHRAKT--FRMKVVLLAITWILAFLMYGPAiilwdvlt-gvspikvnRCEA 160
gi 443693870  82 FDYLLCAESSLTIILISLDRFLMVHLGpgtYQKHVt-PNRTIGALAVSWVCAFLLYGPAiigtdlwr-gyttvktgDCDV 159
gi 405962108 145 VDFTLCLESIITIVMISFDRLLLLKHGp-hYIVKEt-TKKTLIKIFVSWILSFSLYSPAiigwdlwm-gedinepgDCDV 221
gi 443718157 107 FDYLVCVESSFTILCISVDRLLMVKLGpglYQRMVt-KRRTLLLIATTWLISAVLYGPAivafdiwr-gysivpenDCFV 184
gi 405962107 102 IDFALCLESILTIIVISLDRLLLLRYGp-hYSHKEt-PKIAVLKLALTWIVAVSLYSPAiigwdlwt-gedsveqgDCDV 178
gi 14194819   93 TDYLLCTASVYNIVLISYDRYLSVSNAv-sYRTQHtgVLKIVTLMVAVWVLAFLVNGPMilvses-----wkdegsECEP 166
gi 443693053 107 LDYMVCAESSFTVLFISLDRLLMVKLGpgaYQRIVt-KRRTALLIATTWLASFVLYGPTiaafdvmr-gysivpenDCFV 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #  ##  #                                                               
gi 17366878  192 EFf-yNWYFLITASTLEFFTPFLSVTFFNLSIYLNIqrrtrlrldggareagpdplpeaqssppqpppgcwgcwpkgqge 270
gi 390344266 184 EFt-gHLVITLIVNVLQFFIPFTILLSLNIAVYNNIrqrsrgivgpsppilppadlpgpgarrlppdslkatt------- 255
gi 291233961 230 ESw-dNLYYQILLIALEFVLPLVALAYLNSSIYAYIrrrdrrwhdknnriklavemskpdidqqkvekgkiisiskaksh 308
gi 118403355 161 DFplrSAAYTFAMSFTEFVVPFGLLSYLYAQVYWHAirwfrrrpsssd-------------------------------- 208
gi 443693870 160 EFs-dMFTYVVITCVLEFCVPLVLVSTFNCLLYLNIhkrskrlhnhnsptdi---------------------------- 210
gi 405962108 222 QFa-yHFIFTTATAIIEFVIPLFAVTIINFLIYLQIrkrtvvsplpngrnfss--------------------------- 273
gi 443718157 185 EFl-dHFKFTAITSIFDFFTPSIAIVLSNVLLYLDIrrrsrstq------------------------------------ 227
gi 405962107 179 QFa-nDLAFTATTAVVEFAIPFIAIGVLNFLIYCKIrkrskispvak--------------------------------- 224
gi 14194819  167 GFf-sEWYILAITSFLEFVIPVILVAYFNMNIYWSLwkrdhlsrcqshpgltavssnicghsfrgrlssrrslsastevp 245
gi 443693053 185 EFf-nHLTITAVTAVFDFFTPSVLIILFNALLYLDIrqrtrtsr------------------------------------ 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 17366878  271 smplhrygvgeagpgaeageaalgggsgaaasptsssgsssrgterprslkrgskpsassaslekrmkmvsqsitqrfrl 350
gi 390344266 256 -------------------------------------------sksisaalpaepcpdkyapstslnaprdpsktegwtf 292
gi 291233961 309 veikredsgsddgee------sdtfdnnvpdtntdnitlddpvtrnsesktqianggkmrtyfksfsarrksvqpnlkkh 382
gi 118403355 209 ---------------------------------------------------------------------ggrgiptelgk 219
gi 443693870 211 -----------------------------------------------------------------skldnaetlrrmrnl 225
gi 405962108 274 ----------------------------------------------------------------npiteqttsaeerekt 289
gi 443718157 228 -------------------------------------------------------------------------qvdqgcl 234
gi 405962107 225 ---------------------------------------------------------------------dalpsvttavd 235
gi 14194819  246 asf------------------------------hserqrrksslmfssrtkmnsntiaskmgsfsqsdsvalhqrehvel 295
gi 443693053 228 -------------------------------------------------------------------------qddqmsl 234
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
Feature 1                            #  ##  #                #   #   #                     
gi 17366878  351 SRDKKVAKSLAIIVSIFGLCWAPYTLLMIIRaach-ghcvPDYWYETSFWLLWANSAVNPVLYPLCHysFRRAF 423
gi 390344266 293 ARHRKAAVVLGILVGCFLVCWVPIQITSVMFsicg-tkcvTYLNWEVTNALVWGNSLINPFIYAATNrhFRRNF 365
gi 291233961 383 RKHKKAAKRLAILVGTFVICWAPYKIVSLVKifca--dcsNEKVWEFVNYLLWCNSTINPLLYAFCNrrIRYNY 454
gi 118403355 220 MFHRRLAVNLTILLLVFFVCWCPYMVGTMVLsqcatcidyHSIAFVALDWLLWTNSAINPFLYAYCSprFREGA 293
gi 443693870 226 RRDRKAARVLFILVIAFFVCWSPYSLTTIFYsvcg-dscvNFDMYELFTWLLWINSSLNPYLYAYANtrIRKHF 298
gi 405962108 290 RKDIKAARFLAMLVLVFAITWAPYTIATIIIsfcd--sciDTYFYEFLVWLLWAKSAINPFLYALNSalFYKNF 361
gi 443718157 235 KRDLKAAKNLALLVALFLMCWAPYTTCALLQtics--scvNADLFNFFVWLLWMNSSINPIVYAASNprFRSHY 306
gi 405962107 236 AKNRKAARFLAMLVVVFGITWAPYTVSTIIIsfcd--scvDVNLYEAFNWLLWSKASLNPFLYAYNSarFAKNF 307
gi 14194819  296 LRARRLAKSLAILLGVFAVCWAPYSLFTIVLsfyssatgpKSVWYRIAFWLQWFNSFVNPLLYPLCHkrFQKAF 369
gi 443693053 235 RKDLKAAKNLAILALVFLICWAPYVACALLEtics-sscvNVDLLNFFTWLLWLNSSINPLMYAASIprFRRHF 307

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap