Conserved Protein Domain Family
7tmA_tyramine_octopamine_R-like

?
cd15060: 7tmA_tyramine_octopamine_R-like 
tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes tyramine/octopamine receptors and similar proteins found in insects and other invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320188
View PSSM: cd15060
Aligned: 9 rows
Threshold Bit Score: 366.756
Threshold Setting Gi: 12644003
Created: 13-Nov-2008
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                    #   
gi 12644003  110 LLTALVLSVIIVLTIIGNILVILSVFTYKPlrivQNFFIVSLAVADLTVALLVLPFNVAYSIlg-rWEFGihlCKLWLTC 188
gi 12229835   33 VAATALLLAIILVTIVGNSLVIISVFTYRPlrsvQNFFVVSLAVADLTVALFVLPLNVAYRLln-qWLLGsylCQMWLTC 111
gi 57014117   58 VLGTITYLVIIAMTVVGNTLVVVAVFSYRPlkkvQNYFLVSLAASDLAVAIFVMPLHVVTFLaggkWLLGvtvCQFFTTA 137
gi 41397456   41 VVSVVSLSIVTCFTFVGNALVIVSVLSYRPlrivPNYFIVSLAVADLTMAVFVLLLGAANTImg-kWVFGdclCRAWLTI 119
gi 165906130  48 VVTVISLSIIIVFTIVGNVLVILSVFTYRPlrivQNFFIVSLAVADLTVAVFVLPFNVAYSIig-kWIFGihlCQMWLTC 126
gi 215510153  70 IVTVVVLSAIVAGTVFGNVLVVLAIFTYRPlrsvQNMFIVSLAVADIAVALLVMPLNVAYSIlg-rWVFGlhtCKLWLTC 148
gi 212510178  39 IITLILLVALTIFMILGNIFVILSVLLYQPlrtvQNFFIISLAMSDLMVAILVLPINLVYFLlg-kWLFGiviCKMWLTM 117
gi 443692916   7 ISFSILMSVCICMTIVGNILVILSVFTYRPlrsvQNFFIVSLAVADLAVAILVMPFNVANFVig-rWMFGaifCNMWLTF 85
gi 405972120  14 YILTFLMIVTIAVTIVGNIFVVQAILTYKPlrnvQNLFLISLAVADLAVAIIVMPLHIANKLqg-nWTFGgplCNFWVTC 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ##  ##                                                                       #  
gi 12644003  189 DVLCCTSSILNLCAIALDRYWAITDPinYAQKRtVGRVLLLISGVWLLSLLISSPPLIGWNDwpdef---tsatPCELts 265
gi 12229835  112 DILCCTSSILNLCVIALDRYWAITDPinYAQKRtIRRVNTMIAAVWALSLVISVPPLLGWNDwpaqf---tedtPCTLtq 188
gi 57014117  138 DILLCTSSILNLCAIALDRYWAIHNPinYAQKRtTKFVCIVIVIVWILSMLISVPPIIGWNNwqen----mmedSCGLst 213
gi 41397456  120 DILCCTASILNLCAIALDRYWAISDAinYAQKRtAPRVLFMIGVVWTMSIVICLPPIFGWNNwegs----tpkePCTPtn 195
gi 165906130 127 DIMCCTASILNLCAIALDRYWAITDPisYAQKRtLKRVLIMIGLVWVISVIICLPPLFGWNDwpdvf---tedtPCILte 203
gi 215510153 149 DVLCCTASILNLCAIALDRYWAIHDPinYAQKRtLRRVLLSIVLVWAISALISVPPLIGWNDwpeef---detsPCQLte 225
gi 212510178 118 DVLLCTASILNLCAIALDRYWAITDPinYALKRtMRRVLFMISGVWLISALISSPPLLGWNDwpdnf---hdktPCQLte 194
gi 443692916  86 DILTCTASILNLCAIALDRYYAIHDPirYAQKRtLKRVLVSIAVVWAASALISVPPLIGWNNssgntlynentqKCELtn 165
gi 405972120  93 DVLLCTASILNLCVIALDRYFAIHDPlsYAQKRtITRVLLMIVAGRGASSIISVPPLFGWIDspenslykektkQCSLta 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            #  ##  #                                                                    
gi 12644003  266 QRGYVIYSSLGSFFIPLAIMTIVYIEIFVATrrrlreraranklntialkstelepmansspvaasnsgsksrllaswlc 345
gi 12229835  189 ERLFVVYSSSGSFFIPLIIMSVVYAKIFFATkrrlrertrklgtlavpappqrtssrplaelesvasqe----------- 257
gi 57014117  214 EKAFVVFSAAGSFFLPLLVMVVVYVKIFISArqrirtnrgrsalmriqnaegdddyrkmsikrasvesartssrvgektp 293
gi 41397456  196 DKGYVIFSAIGSFYCPLLIMIILNVKIFRSIrkrlrkrvsrqsqildlpsarfsrleavtpamlhapprrvhtlt----- 270
gi 165906130 204 EKGFVIYSSSGSFYCPLLIMTTVYVKIFTATrrrlrerakasklneipyrgkaripkeedsavsengqngynesckkklv 283
gi 215510153 226 ERGYVLYSASGSFFAPMFIMTIVYFKIFLATrrrlrkramavaatlqvkatvqipqpaihenssadspqteqspi----- 300
gi 212510178 195 KHGYVIYSSLGSFYVPLFIMGSVYIEIFIATrkrirgryqrttnlmkltqepshlntnqtpsdvklnqntsideksnvsv 274
gi 443692916 166 EKGFVIYSASGSFYIPLFIMTFVYVNIFRATrrrlrarakaaaasklkkpssdespehttactscksgskvahdknsnkh 245
gi 405972120 173 ERGYIIYSSFGSFFIPLTIMTFVYIKIFFATrerlrkrakasaaskmallktrsppspnltveqlsedsnenne------ 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 12644003  346 cgrdraqfatpmiqndqesissethqpqdsskagphgnsdpqqqhvvvlvkksrraktkdsikhgktrggrksqssstce 425
gi 12229835      --------------------------------------------------------------------------------
gi 57014117  294 lviadgqttv---------------------------------------------------------------------- 303
gi 41397456      --------------------------------------------------------------------------------
gi 165906130 284 hkkkkkkrkqstasepn--------------------------------------------------------------- 300
gi 215510153     --------------------------------------------------------------------------------
gi 212510178 275 lpdd---------------------------------------------------------------------------- 278
gi 443692916 246 lkngakarktatalk----------------------------------------------------------------- 260
gi 405972120     --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 12644003  426 phgeqqllpaggdggscqpggghsgggksdaeistesgsdpkgciqvcvtqadeqtslkltppqsstgvaavsvtplqkk 505
gi 12229835  258 -----------------------------------------------------------detepspepeplssradkpan 278
gi 57014117  304 --------------------------------------ttlaahstdggslpkdettkhmkyhnngsckvkvkdvkedeg 345
gi 41397456  271 -----------------------------------------------------eyyrkrsdsdtlptkasqrrastvmrd 297
gi 165906130 301 -------------------------------ssgtnpnlvpppiaetsitendisntkdettpveeekknevavkigpkg 349
gi 215510153 301 -----------------------------------------------------dpdmdsvtavkveeplepkpqlnggrs 327
gi 212510178 279 -------------------------------------------skksfdaqegssethknmvnstelhnednkikktvki 315
gi 443692916 261 --------------------------------ksggarskiglfvqnkdtrdalhpaeaemltasrevipekeakppppv 308
gi 405972120 247 ------------------------------------------------------nhnrefsynatpnhsalllneriten 272
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                            #  ##  #                 #   #   #          
gi 12644003  506 tsgvnqfieekqkislSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCqtc--cpTNKFKNFITWLGYINSGLNPVIY 583
gi 12229835  279 gisvhqfieekqrislSKERKAARVLGVIMGVFVVCWLPFFLMYAIVPFCtnc-appSQRVVDFVTWLGYVNSSLNPIIY 357
gi 57014117  346 npnptavlrkrekisvAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCetc--klHAKVEQAFTWLGYINSSLNPFLY 423
gi 41397456  298 dnevfqvirrtgkislTKERRAARTLGTVMGAFVVCWLPFFLMYVILPFCpsc-tspSRKXQNFIIWLGYLNSAFNPVIY 376
gi 165906130 350 gnqihqfieekqkislSKERRAARTLGIIMGSFVVCWLPFFLMYVILPFCstc--qpNEKLVNFIVWLGYINSSLNPVIY 427
gi 215510153 328 vpnvkqymeerqrislSKERRAARVLGIVMGVFVLCWLPFFLMYVILPFCanc--yiSTKTVNFITWLGYVNSALNPVIY 405
gi 212510178 316 hfhmdhfieekqrisiSKEKKAARTLGIVMGVFVICWLPFFIMYMILAFCevc--cvSFRFRSFITWLGYVNSAVNPIIY 393
gi 443692916 309 pnqmhqfleerqkislSKERRAARTMGIIMGAFVACWLPFFLMYIIFPFCdactasaDHRFTNFIVWLGYINSALNPIIY 388
gi 405972120 273 antmqnffdqrqkislSKERKAARTLGIIVGAFILCWLPFFIMYVTVPFCssc--nlTPGVELGMTFLGYVNSALNPVIY 350
                        490
                 ....*....|.
Feature 1                   
gi 12644003  584 TIFNlDYRRAF 594
gi 12229835  358 TIYNkDFRTAF 368
gi 57014117  424 GILNlEFRRAF 434
gi 41397456  377 TFFNkDFCNAV 387
gi 165906130 428 TIFNlDFRRAF 438
gi 215510153 406 TVFNnDFRKAF 416
gi 212510178 394 TIFNrDFRKAF 404
gi 443692916 389 TIFNiDFRRAF 399
gi 405972120 351 TVFNvDFRKAF 361

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap