Conserved Protein Domain Family
7tmA_tyramine_R-like

?
cd15061: 7tmA_tyramine_R-like 
tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes tyramine-specific receptors and similar proteins found in insects and other invertebrates. These tyramine receptors form a distinct receptor family that is phylogenetically different from the other tyramine/octopamine receptors which also found in invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320189
View PSSM: cd15061
Aligned: 8 rows
Threshold Bit Score: 273.082
Threshold Setting Gi: 16876479
Created: 13-Nov-2008
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                    #   
gi 37542077  118 ILIAVFATFIVVTVIGNTLVILAILTTRRlrtiTNCFVMSLAVADLLVGIFVMPPAVAVHLig-sWQLGwv-lCDIWISL 195
gi 322802579  39 ILAGLFTMLIIVTIVGNTLVIAAVITTRRlrsvTNCFVSSLAAADLLVGLAVMPPAVLLQLtggtWELGei-lCDFWVSL 117
gi 443728680   2 LLGIMFGIVDIAAIVGNILVIISVAINPRlrtvTNCFVVSLASADLLVGILVLPLGIKVEIvg-nWGLGtm-lCDVWISF 79
gi 71994106   73 FIALFLVMLILLTIFGNILVVLSVVVYKRmrtfTNILLTSLATADLLVGLIVMPMSLLDLLhnhrWPLGrf-lCRMWATS 151
gi 353232031  44 IIISLQILSGIFIFGGNLLVISAVATTKGlrriTDLYIVSLALADLLVAVLVLPHFIMRQVyg-yWPYEshelCIYWLSL 122
gi 316974840   7 VWVIVLAVMCLFAIIGNGLIILSVSVYRGmqttPNILLVSLATADFLVSILVMPVALIDMAfkhtWQFGrl-iCRLWSTA 85
gi 16876479   32 TISLFLIIATGTTFFGNLLIILAFITNSRlrriTDQYIVSLAVADLLVSVLVLPLAIVRQNlg-yWPFEsdrlCQFWLSA 110
gi 253807585  38 ILTSCLTLATIIIFFGNLLIILWIATRNRlkriCDLYIASLALADFLVSVFVLPFAIIRQNlg-yWPFEstllCQFHISS 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ##  ##                                                                          
gi 37542077  196 DVLLCTASILSLCAISVDRYLAVTRPltysrkRRSKRLALIMILIVWLLALAITCPPMLGWyepgr---------rdlrE 266
gi 322802579 118 DILLCTASILSLCAISIDRYLAVTQPliysrrRRSKRLAGLMIVAVWVMAGAITSPPLLGCfprat--------nrdikK 189
gi 443728680  80 DVMLCTASILNLCCISLDRYFAITNPmvy-vtKRSKRLALVMICVVWVASIIITCPPIFGWreegr--------nelesQ 150
gi 71994106  152 DVLLCTASILNLCVISLDRYFAITSPlky-prTRSRKMAAGLLTAVWAISFVVCSPPWVIPswnlfidnnnntgssedfK 230
gi 353232031 123 NLFLCSASILNICCISVDRYVAINYPmky-tsKQTRRTAFLMIGCAWVASFLVMTPPIFGSqhhn-----------gvgS 190
gi 316974840  86 HVLLCTASILNLCIIGLDRYFAITDPlky-kgRQTRRLAITALLFVWCIALLISSLPLVIPawefp---------dqldS 155
gi 16876479  111 NIVLCMASILNLCCISLDRYIAISRPmky-ftKRTRFTASTMIAVAWILPLITMLLPFVGGnqht----------lglgS 179
gi 253807585 117 DIFLCMSSILNLCCISIDRYVAISYPlqy-itKQSRRISIIMILIAWIIPSFSILPPLFGMskhv-----------tgvG 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          #       #  ##  #                                                              
gi 37542077  267 CRYn-qNEGYVIFSAMGSFFIPMAVMIYVYARISCVIasrhdnmtdisvhnkkfkrytaadvenelseqeqhssvgqrqr 345
gi 322802579 190 CSYn-mDSSYVIFSAMGSFFLPMLVMLYVYGRISCVIasrhrnlektnegenvrsrrkitidrgrsikaqrsny------ 262
gi 443728680 151 CFLt-rDPGYIIYSSLGSFYIPLVIMIFVYARIFKVAherekrlrpyrrsfvngqrrsanpsndgtpq------------ 217
gi 71994106  231 CAYs-pSVAYRIYSALGSFYLPLLVMLFVYFKIFRVAserealmrqsvgtcrlsnrltktqqknqrnnlrtasaphsrtr 309
gi 353232031 191 CYIr-sDAGYRFLTGICIFFVPFLLVGFIYIRIFWVIhrrwkelkfgkflfnpkehrfgsfkllfvanniynrsfghkky 269
gi 316974840 156 CTYp-tMLSYRIYSSMASFYIPLMLILFVYCKIVRVIrcrlrtidslnsecnrlsevkplqhalieqslseksqsvvlss 234
gi 16876479  180 CHIt-yNKAYRIYSSIVGFFGPFLLIAYIYLRVFWIIkhrlkvlqitniklsslkkpkshikatrkpapiiinlqqvwen 258
gi 253807585 185 CCYisySKEYRIYSSVLAYFLPIILIGYVHLRIFYIIrrrskvfnpfnidskkqesrtnlsrliplltdhfskrfiqrnk 264
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 37542077  346 qatsrtfsnqtiakelqdmmlsdsdncaamgaggaggggggassatggthcqsllalpsggvggsmgcakng-------- 417
gi 322802579     --------------------------------------------------------------------------------
gi 443728680     --------------------------------------------------------------------------------
gi 71994106  310 vqvnhncgrvnysvrpveyanrvenslkpsherfdstdcedsppngdsleagtt-------------------------- 363
gi 353232031 270 cfsshnsnqrqlfvtnstqsnlfiayttstrrknvgkytvnqshvqssssslvdkrseqiervy---------------- 333
gi 316974840 235 dnsnrtslgnaqrpsnspadgfsgciifgsfftvlswtqstlqllspngsgrarr------------------------- 289
gi 16876479  259 ikgkigkvnilrnqsskskntcpysghffhsdengcnqiyascllnhkhpfdsfrsddilneeidrnyrqkildikmnkt 338
gi 253807585 265 klendisllhfnnihnndiditdalsytyhwtndcidskdiyhrnkidfyfdts-------------------------- 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 37542077  418 ------------------cyeltrpsslkrastasttittmtsgmgpgsslldaqwqsqppgqtgqvqthslsqpprths 479
gi 322802579     --------------------------------------------------------------------------------
gi 443728680     --------------------------------------------------------------------------------
gi 71994106  364 -------------------------------------cnismslvtnsppnglqkeaknsmerechsladivnsadtpvr 406
gi 353232031 334 --------------------------setstqyaqhiqivpiplvhrktksdancfssfsihnstenteiytsqttdtid 387
gi 316974840 290 ------------------------------------vckaqpkgrtirsfstiatntttgpfmseariakplktsssfcq 333
gi 16876479  339 drefsltsqdhveldfpeptdqklkviqifnistsekelqkanweptpnvtlksetkqhqhdylhrsneeqknklgdkql 418
gi 253807585 319 ------------------------------------neleinepepvdenlktlyifhipitehdvidesyldesllnkh 362
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                 #  ##  
gi 37542077  480 frhshgerdrerlrshhhhphyhhqagvtttstsgntsantnskslsnritslKKENKTTQTLSIVVGGFIACWLPFFIN 559
gi 322802579 263 ----------------aesgitcdkpsedteltnmckklgtirgnqqscinrvARETKTAGTLAVVVGGFIACWLPFFIL 326
gi 443728680 218 ----------------------rtptihrdppsytheatesesreddmedrliETERKTAKTLAVVVGCFVVCWLPFFLM 275
gi 71994106  407 kntevgvapslskrarqcnarlqpnnllqkahehyqingpgkavrgskekmvyMRERKALKTIGIVVLGFIICWMPFFIM 486
gi 353232031 388 ktndasindrrkdqqrenehrinsqnkgilnskpkhsnthnsmiyqrrkrlvyDSEKKTVKTVALVVCCFVLCWLPFTIS 467
gi 316974840 334 tnqqsrkafavisnnrhshdsggpeagrrfhsfsglfnneisitrrlfasslqAKERRAIVVVCIVVSGFTVCWLPFFTL 413
gi 16876479  419 inssklpsltsfsidhikklrrlkslpnfkteynkteqsqknliyyrhdhfifHREQKTALILAAVVGCFTICWFPFFIC 498
gi 253807585 363 tsssngcfngmvskcqylykhrnrsslrnksvcerktertiktqrqfcekvifNKEQKAVRTVTIVIGCFIVCWTPFFIF 442
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #                                                   #   #   #                   
gi 37542077  560 YLITpfla------------------------------------ehqaSQMLAKALTWLGWFNSAINPFIYAFYSvdFRA 603
gi 322802579 327 YLVTpfvp-------------------------------------vqpPDVLMPALTWLGWINSAINPFIYAFYSadFRL 369
gi 443728680 276 YVIEpfca------------------------------------gcdfHPVLKTCITWLGYCNSVINPFIYAFYNrdFRS 319
gi 71994106  487 YLVEvfisdp--------------------------------vaespiYRITSEFFLWLGYSNSVLNPIIYTMYNgdFRR 534
gi 353232031 468 YLMEgace-------------------------------------yifSEAFNMGAGWIAYLNSMCNPFIYAFCNtkYAK 510
gi 316974840 414 HLIEpichahpgvgklkenlaenfqvpstlsvsenlyetssakfscpiSPALSDAFLWLGYFNSLVNPLIYCFCNqdFRR 493
gi 16876479  499 IIGEaicd-------------------------------------cqySNTIITFVSWLGYFNSICNPFIYAFFKkeYAK 541
gi 253807585 443 YLSEaicd-------------------------------------ctfSEELYTIVTWLGYFNSIFNPFIYGFYNkeYAN 485

                 ..
Feature 1          
gi 37542077  604 AF 605
gi 322802579 370 AF 371
gi 443728680 320 SF 321
gi 71994106  535 CF 536
gi 353232031 511 AF 512
gi 316974840 494 CF 495
gi 16876479  542 SF 543
gi 253807585 486 AF 487

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap