4IAQ,4IAR


Conserved Protein Domain Family
7tmA_5-HT1_5_7

?
cd15064: 7tmA_5-HT1_5_7 
Click on image for an interactive view with Cn3D
serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes serotonin receptor subtypes 1, 5, and 7 that are activated by the neurotransmitter serotonin. The 5-HT1 and 5-HT5 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family. The 5-HT1 receptor subfamily includes 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as 5-HT2C receptor. The 5-HT5A and 5-HT5B receptors have been cloned from rat and mouse, but only the 5-HT5A isoform has been identified in human because of the presence of premature stop codons in the human 5-HT5B gene, which prevents a functional receptor from being expressed. The 5-HT7 receptor is coupled to Gs, which positively stimulates adenylate cyclase activity, leading to increased intracellular cAMP formation and calcium influx. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.
Statistics
?
PSSM-Id: 320192
View PSSM: cd15064
Aligned: 13 rows
Threshold Bit Score: 326.978
Threshold Setting Gi: 62512163
Created: 17-Nov-2008
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:4IAQ: Human 5-HT1B G protein-coupled receptor binds the agonist antimigraine medication dihydroergotamine, contacts at 4A.
    View structure with Cn3D
  • Structure:4IAR: Human 5-HT1B binds ergotamine, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                    ##  
4IAQ_A        21 VLLVMLLALITLATTLSNAFVIATVYRTRKLhtpANYLIASLAVTDLLVSILVMPISTMYTVtg-rWTLGqvvCDFWLSS 99
4IAR_A        21 VLLVMLLALITLATTLSNAFVIATVYRTRKLhtpANYLIASLAVTDLLVSILVMPISTMYTVtg-rWTLGqvvCDFWLSS 99
gi 112819     39 ISLAVVLSVITLATVLSNAFVLTTILLTRKLhtpANYLIGSLATTDLLVSILVMPISIAYTIth-tWNFGqilCDIWLSS 117
gi 112822     23 MLICMTLVVITTLTTLLNLAVIMAIGTTKKLhqpANYLICSLAVTDLLVAVLVMPLSIIYIVmd-rWKLGyflCEVWLSV 101
gi 231454     37 VITSLLLGTLIFCAVLGNACVVAAIALERSLqnvANYLIGSLAVTDLMVSVLVLPMAALYQVln-kWTLGqvtCDLFIAL 115
gi 398967     24 ILVSLTLSGLALMTTTINSLVIAAIIVTRKLhhpANYLICSLAVTDFLVAVLVMPFSIVYIVre-sWIMGqvvCDIWLSV 102
gi 62512163  227 AVTSVLLGLMILVTIIGNVFVIAAIILERNLqnvANYLVASLAVADLFVACLVMPLGAVYEIsq-gWILGpelCDIWTSC 305
gi 229291511  17 ILTGTSLSIVTLTSILGNALVLVTLTVERHLrtpANSLIGSLAVADLLVSLLVMPISASYELtq-tWRLGramCDIWIIL 95
gi 85857154   47 VLLSIGLGFIIIGTIFGNALTLTAISKHRPLqtpQNHLIASLAVADLMVAILVMPLSLTKEIvv-vWIFGpilCDVWISL 125
gi 405954672  15 IFIAIFAVLIIIGTVFGNSLVILSILMDRRLhrvGNIFIVSLALSDILVGLCVTPFALVYQLqg-vWNFGsifCDFWISM 93
gi 229280946   4 VLTGLALSLLILVAILGNAMVLMAFIKDRRLctpANYLIVSMAVADLLVSVSVMPLNATYELme-tWRLGrpaCDLWISL 82
gi 2494929    71 IVIGVVLSIITLFTIAGNALVIISVCIVKKLrqpSNYLVVSLAAADLSVAVAVMPFVIITDLvggeWLFGkvfCNVFIAM 150
gi 1345607    41 VLILTLLGFLVAATFAWNLLVLATILRVRTFhrvPHNLVASMAVSDVLVAALVMPLSLVHELsgrrWQLGrrlCQLWIAC 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ##  ##                                                                   #      
4IAQ_A       100 DITCCTASIWHLCVIALDRYWAITDAveYSAKRtPKRAAVMIALVWVFSISISLPPFfwrqak---aeeevsECVVntdH 176
4IAR_A       100 DITCCTASIWHLCVIALDRYWAITDAveYSAKRtPKRAAVMIALVWVFSISISLPPFfwrqak---aeeevsECVVntdH 176
gi 112819    118 DITCCTASILHLCVIALDRYWAITDAleYSKRRtAGHAATMIAIVWAISICISIPPLfwrqak---aqeemsDCLVntsQ 194
gi 112822    102 DMTCCTCSILHLCVIALDRYWAITNAieYARKRtAKRAALMILTVWTISIFISMPPLfwrshrr--lspppsQCTIqhdH 179
gi 231454    116 DVLCCTSSILHLCAIALDRYWAITDPidYVNKRtPRRAAALISLTWLIGFLISIPPMlgwrtpe--drsdpdACTIs-kD 192
gi 398967    103 DITCCTCSILHLSAIALDRYRAITDAveYARKRtPKHAGIMITIVWIISVFISMPPLfwrhqg----tsrddECIIkhdH 178
gi 62512163  306 DVLCCTASILHLVAIAVDRYWAVTNId-YIHSRtSNRVFMMIFCVWTAAVIVSLAPQfgwkdpdylqrieqqKCMVs-qD 383
gi 229291511  96 DVTCCTASIMSLCIIALDRYWAITDAvkYVHKRtPKRMMVMIGVVWLLSLCISIPPVfgwrkpe--dtadpnNCLIs-qD 172
gi 85857154  126 DVLLCTASILSLCMISLDRFWAITKPikYPKYRtARTMVILIALAWFLSSIISTSPFfgwrgn---qsidayTCQIs-qN 201
gi 405954672  94 DIICCTASIVNLCVISYDRYNAISQPlhYAQFRtVRRALCLVILAWTYSIVIALPPLlgwktp---nqmtinSCVIs-qN 169
gi 229280946  83 DVTSCTASILSLCVIALDRYWAITDAvkYMHQRtTRRAVVMVALVWVASLCISVPPLfgwrtaq--dvadplVCRIs-qD 159
gi 2494929   151 DVMCCTASIMTLCVISVDRYLGITRPltYPARQnGKLMAKMVFIVWLLSASITLPPLfgwakn----vnverVCLIs-qD 225
gi 1345607   121 DVLCCTASIWNVTAIALDRYWSITRHmeYTLRTrKCVSNVMIALTWALSAVISLAPLlfgwget--ysegseECQVs-rE 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              #   #                                                                     
4IAQ_A       177 ILYTVYSTVGAFYFPTLLLIALYGRIYVEArsriadlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatpp 256
4IAR_A       177 ILYTVYSTVGAFYFPTLLLIALYGRIYVEArsriadlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatpp 256
gi 112819    195 ISYTIYSTCGAFYIPSVLLIILYGRIYRAArnrilnppslygkrfttahlitgsagsslcslnss--------------- 259
gi 112822    180 VIYTIYSTLGAFYIPLTLILILYYRIYHAAkslyqkrgssrhlsnrstdsqnsfasckltqtfcvsd------------- 246
gi 231454    193 HGYTIYSTFGAFYIPLLLMLVLYGRIFRAArfrirktvkkvektgadtrhgaspapqpkksvngesgsrnwrlgveskag 272
gi 398967    179 IVSTIYSTFGAFYIPLALILILYYKIYRAAktlyhkrqasriakeevngqvllesgekstksvstsyvl----------- 247
gi 62512163  384 VSYQVFATCCTFYVPLLVILALYWKIYQTArkrihrrrprpvdaavnnnqpdggaatdtklhrlrlrlgrfstaksktgs 463
gi 229291511 173 HAYTIFSTFGAFYIPLIIVLAVYYKIFRAAqarirkrinsrakmgl---------------------------------- 218
gi 85857154  202 IAYTIFSTFGAYFIPMTIMMIVYARIYCEArkrirgktfnrgcqplnsavnyretanycdrkdseesnkspivkcdpasd 281
gi 405954672 170 VGYTFFSTIGAFYLPLVIMLCFYCKIFQVTwlrgkqwvrgpgnsliikfrqkkglnsyntfryccdsgkkegknlsiekn 249
gi 229280946 160 YGYTIFSTFGAFYVPSAVILVVYWKIFRAAqrrirvrvgaqvpparrnkprssdnddtagesrpvtpvrhnrrqqksqdr 239
gi 2494929   226 FGYTVYSTAVAFYIPMTVMLVMYQRIFVAAkisaekhkfvniprlyeqegiycledklpp-------------------- 285
gi 1345607   198 PSYAVFSTVGAFYLPLCVVLFVYWKIYKAAkfrvgsrktnsvspiseavevkdsa------------------------- 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4IAQ_A       257 kledksp------------------------------------------------------------------------- 263
4IAR_A       257 kledks-------------------------------------------------------------------------- 262
gi 112819        --------------------------------------------------------------------------------
gi 112822        --------------------------------------------------------------------------------
gi 231454    273 galcanga------------------------------------------------------------------------ 280
gi 398967        --------------------------------------------------------------------------------
gi 62512163  464 avgvsgpasggralglvdgnstntvntvedtefsssnvdsksragveapstsgnqiatvshlvalakqqgkstakssaav 543
gi 229291511     --------------------------------------------------------------------------------
gi 85857154  282 nhkggvfdgstlshsmlaasapn--------------------------------------------------------- 304
gi 405954672 250 sdeskenhiekvtvdngmqpnfdhqiniekptctkskrptlvrqis---------------------------------- 295
gi 229280946 240 enisi--------------------------------------------------------------------------- 244
gi 2494929       --------------------------------------------------------------------------------
gi 1345607       --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4IAQ_A           --------------------------------------------------------------------------------
4IAR_A           --------------------------------------------------------------------------------
gi 112819        --------------------------------------------------------------------------------
gi 112822        --------------------------------------------------------------------------------
gi 231454        --------------------------------------------------------------------------------
gi 398967        --------------------------------------------------------------------------------
gi 62512163  544 ngmapsgrqeddgqrpehgeqedreeledqdeqvgpqpttatsattaagtnesedqckangvevledpqlqqqleqvqql 623
gi 229291511     --------------------------------------------------------------------------------
gi 85857154      --------------------------------------------------------------------------------
gi 405954672     --------------------------------------------------------------------------------
gi 229280946     --------------------------------------------------------------------------------
gi 2494929       --------------------------------------------------------------------------------
gi 1345607       --------------------------------------------------------------------------------
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4IAQ_A       264 ----------------------------------------------------------------dspemkdfrhgfdilv 279
4IAR_A       263 -----------------------------------------------------------------pdspemkdfrhgfdi 277
gi 112819        --------------------------------------------------------------------------------
gi 112822        --------------------------------------------------------------------------------
gi 231454    281 ---------------------------------------------------------------vrqgddgaalevievhr 297
gi 398967        --------------------------------------------------------------------------------
gi 62512163  624 qksvksgggggastsnattitsisalspqtptsqgvgiaaaaagpmtaktstltscnqshplcgtanespstpeprsrqp 703
gi 229291511     --------------------------------------------------------------------------------
gi 85857154  305 -----------------------------------------------lqnqhkvgedvkkdtfvtsltvpgqhqatftst 337
gi 405954672 296 ------------------------ylsstdsgyttsgeasvssdaredqgcmpsiaedeiiteivdietgkliikgrdgq 351
gi 229280946 245 -----------------------------------------------------------------nvkvisvqpavhsrl 259
gi 2494929       --------------------------------------------------------------------------------
gi 1345607       --------------------------------------------------------------------------------
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                    #  ##     #         
4IAQ_A       280 gqiddalklanegkvkeaqaaaeqlkttrnayiqkyllmaARERKATKTLGIILGAFIVCWLPFFIISLVMPICkda--c 357
4IAR_A       278 lvgqiddalklanegkvkeaqaaaeqlkttrnayiqkylaARERKATKTLGIILGAFIVCWLPFFIISLVMPICkda--c 355
gi 112819    260 ------lheghshsagsplffnhvkikladsalerkrisaARERKATKILGIILGAFIICWLPFFVVSLVLPICrds--c 331
gi 112822    247 ---fstsdpttefekfhasirippfdndldhpgerqqissTRERKAARILGLILGAFILSWLPFFIKELIVGLSiy---- 319
gi 231454    298 vgnskehlplpseagptpcapasferknernaeakrkmalARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCess--c 375
gi 398967    248 --ekslsdpstdfdkihstvrslrsefkhekswrrqkisgTRERKAATTLGLILGAFVICWLPFFVKELVVNVCdkc--- 322
gi 62512163  704 ttpqqqphqqahqqqqqqqqlssianpmqkvnkrketleaKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCaac--- 780
gi 229291511 219 ------------------------sqalqsrivtqkkilfSKERKAAQTLGVITGVFVFCWLPFFLVALIGPFCshc--- 271
gi 85857154  338 slreinsnespssqrsllsspsplpgqiqererrrramatAREHRATKTLGIVTGAFLVCWLPFFLHALIVPLCgea--c 415
gi 405954672 352 dtngvnipksipkpnvtgkkghvttarkrrrlkrkdtislPQERRAVRTLGIVVGCFLVCWLPFFIIAILVPLCphc--- 428
gi 229280946 260 dsstttattpepqaggsscksasstattsvaqnlkkkivfSKERRAAKTLGIITGVFIVCWLPFFLVALIEPFCasc--- 336
gi 2494929   286 ----------kknskkkkaveefaslsklirqdrknisifKREQKAARTLGIIVGAFTFCWLPFFLLSTARPFIcgimcs 355
gi 1345607   253 ---------------kqpqmvftvrhatvtfqpegdtwreQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCsc---- 313
                        570       580       590
                 ....*....|....*....|....*....|....*.
Feature 1           #  ##  #   #                     
4IAQ_A       358 wfHLAIFDFFTWLGYLNSLINPIIYTMSNedFKQAF 393
4IAR_A       356 wfHLAIFDFFTWLGYLNSLINPIIYTMSNedFKQAF 391
gi 112819    332 wiHPALFDFFTWLGYLNSLINPIIYTVFNeeFRQAF 367
gi 112822    320 tvSSEVADFLTWLGYVNSLINPLLYTSFNedFKLAF 355
gi 231454    376 hmPTLLGAIINWLGYSNSLLNPVIYAYFNkdFQNAF 411
gi 398967    323 kiSEEMSNFLAWLGYLNSLINPLIYTIFNedFKKAF 358
gi 62512163  781 qiSDSVASLFLWLGYFNSTLNPVIYTIFSpeFRQAF 816
gi 229291511 272 hiSDVIKSVVLWLGYVNSMVNPFLYAFLNkdFQKSF 307
gi 85857154  416 nvPRSLESIFLWLGYFNSMLNPIIYTKFNqdFQKAF 451
gi 405954672 429 vfPKAVQSLALFLGYFNSACNPVIYTFFNkeFRAAF 464
gi 229280946 337 tiSPLGRSVITWLGYANSAMNPVLYGFVNkdFQKAF 372
gi 2494929   356 cmPLRLERTLLWLGYTNSLINPLIYAFFNrdLRTTF 391
gi 1345607   314 diPAIWKSIFLWLGYSNSFFNPLIYTAFNknYNSAF 349

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap