Conserved Protein Domain Family
7tmA_Dop1R2-like

?
cd15067: 7tmA_Dop1R2-like 
dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
G protein-coupled dopamine 1-like receptor 2 is expressed in Drosophila heads and it shows significant sequence similarity with vertebrate and invertebrate dopamine receptors. Although the Drosophila Dop1R2 receptor does not cluster into the D1-like structural group, it does show pharmacological properties similar to D1-like receptors. As shown in vertebrate D1-like receptors, agonist stimulation of Dop1R2 activates adenylyl cyclase to increase cAMP levels and also generates a calcium signal through stimulation of phospholipase C.
Statistics
?
PSSM-Id: 320195
View PSSM: cd15067
Aligned: 10 rows
Threshold Bit Score: 373.23
Threshold Setting Gi: 358336121
Created: 16-Jul-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2494958   110 GLLAFLFLFSFATVFGNSLVILAVIRERYLht-aTNYFITSLAVADCLVGLVVMPFSALYEVle---------------- 172
gi 118402734  23 IVILVLSLFTVFTIAGNLLVIAVVYRDRKLrt-vTNYLIVSLAFADLLIGSLVMPFGISLEVtg---------------- 85
gi 94730443   44 LLAIALFSICLLTVAGNCLVVIAVCTKKYLrn-pTGYLIISLAIADLIVGVIVMPMNSLFEIan---------------- 106
gi 291234542 112 LLAIVLTLFAIVIVFGNSLVILAVYRERYLrt-tTNCFIVSLAFSDLLIGLVVVPFAMINDTsg---------------- 174
gi 291244554 104 LLGLFLSLCCMVTVLGNILVMVAVSRMSYLrt-vTNFFIVSLAVADLLVGSIIIPFTITLEMtg---------------- 166
gi 215501723  78 ALGVLLGFFCFVTIFGNVLVMLSVAKEQYLht-vTNYFIASLATADCLVGAVVMPFSAIHEImd---------------- 140
gi 321474780  40 ILALVLFSFCLATVLGNALVIAAVTRERYLht-vTNYFIMSLAVADCLVGSIVMPFSAAVEMqsd--------------- 103
gi 405970916  66 AIGVVLAMFSFITVAGNILVIAAVSKELYLrt-vTNYFIVSLAVADLMVGSIVMPFAITMEMtg---------------- 128
gi 360043110  54 LLGVLLIVAALLTITGNVLVFIAFLRERYMrknlTNWFLVSLAIADLLVGIIVMPFAIYHTLyd---------------- 117
gi 358336121  13 IVVAVLSVLTSVTIGGNLLVMLAILLEPRLrqsvTNCFIFSLAAADLLLGTVVMPFSIVEYWrqryvddytqnmnhdstf 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                    #   ##  ##                                                          
gi 2494958   173 ntWFFGtdwCDIWRSLDVLFSTASILNLCVISLDRYWAITDPfsYPMRMtVKRAAGLIAAVWICSSAISFPAIVWWRaar 252
gi 118402734  86 geWLFGrlwCDIWHSLDVMGSTASILNLCAISLDRYWAITDPvlYPCRVtVGRARLMIALVWLCSSAISFPAIAWWQavg 165
gi 94730443  107 htWLFGlmmCDVFHAMDILASTASIWNLCVISLDRYMAGQDPigYRDKVsKRRILMAILSVWVLSAILSFPGIIWWRtss 186
gi 291234542 175 gyWVFGtlwCDLWHAIDVLASTASIMNLCVISLDRYWAVTYPmsYPTAMtKRVASILISLVWLVSSSISFPCILWWKavd 254
gi 291244554 167 gyWPFGviwCDLWRSFDVLSATASIMNLCVISLDRYWAITDPisYPGRMsFKRAYITIFFVWFCSMSISFPAIAWWRavd 246
gi 215501723 141 kyWIFGqdlCDVWHSIDVLASTASILNLCVISLDRYWAITDPisYPCRMtQAKATTLIAVVWVCSALISFPAIAWWRavn 220
gi 321474780 104 rrWLFGrdlCDVWHSFDVLASTASILNLCVISMDRYWAITDPftYPSRMtPKRAACFIALVWVCSSLISFPAIAWWRava 183
gi 405970916 129 qvWLFGpewCDMWHSFDVLASTASILNLCGISLDRYWAITDPikYASRMtACRTWLSIALVWLLSAGISFPAIAWWKavt 208
gi 360043110 118 ayWPFGrdwCDIWHAFDVLSSTASILNLCAIALERFWATENPitHTSMRtRRHCLLMLTIVWICSVLISFPAILWWRntq 197
gi 358336121  93 elWPYGqgwCDTWHAFDVLSCTASILNLCVISVERYIAVSDPvsYQTRVtHSRSIIMIASAWICSALISFPAIVWWRasl 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                      #      #  ##  #                                   
gi 2494958   253 dg--------------------empayKCTFTeHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAviqtrslkigtkqvlm 312
gi 118402734 166 dp--------------------gspdhLCLFTsDTTYLATSSCVSFYAPLLIMLFTYYRIYRIAarqrkslmqgvkvfda 225
gi 94730443  187 phl-------------------yedqsQCLFTdSKMYVSFSSLVSFYIPLFLILFAYGKVYIIAtrhskgmrmgiktvsi 247
gi 291234542 255 pp---------------------appnTCLFTeDVKYLIISSCVSFYIPTVIMIFTYYKIYRAAttqlrhirhgtkrvna 313
gi 291244554 247 pi--------------------dngknVCLFTdDTLYRILSSCISFYVPLFVMVFVYYKIYRAAaiqmrsrldsqirrgn 306
gi 215501723 221 kg--------------------ppaafQCAFTdDVGYLVFSSTISFYAPLMVMVFTYYRIYRAAveqtrnlklgskqvqs 280
gi 321474780 184 ri--------------------hplpeHCVFTdDIGYLVFSSTVSFYGPLSVMVFTYYRIYRAAvaqsrslrlgikqvvm 243
gi 405970916 209 pdt-------------------psaenECIFTsDSAYLIISSLVSFYCPSIIMMFVYWRIYMAAtaqirslkvgqktlra 269
gi 360043110 198 dyd-------------------nsspeVCHFTsDSIYLFVSSCVSFYIPLVVMLVVYARIYRTAnnlmkyqtdfkrsysf 258
gi 358336121 173 sgrakptngplnstaaelksfstvsttDCVFPdNQLYLFLSSCVSFHIPLVVMIVVYWRIYKSAtkvlkslergvkilnn 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2494958   313 asgelqltlrihrggttrdqqnqvsggggggggggggggsls-------------------------------------- 354
gi 118402734 226 dgkdgesfslrvhrgggtgrk----------------------------------------------------------- 246
gi 94730443  248 kkrngkksntetesilsseneptlrihfgrgkqsssslrnsrfharestrlllkqvsckslndrgehnnnntvrqpllrg 327
gi 291234542 314 spgarkvngevelrihrgg------------------------------------------------------------- 332
gi 291244554 307 r------------------------------------------------------------------------------- 307
gi 215501723 281 cngdettsvtlrihrggmlqaa---------------------------------------------------------- 302
gi 321474780 244 astgemgkgtgggsgsgsggsgsaetvellt------------------------------------------------- 274
gi 405970916 270 tngasgnrevmtlrihrgggntgtnmsrqssdeyg--------------------------------------------- 304
gi 360043110 259 silsclshpqdsqrfkksqcqksqilpfqsstytknpqrlqfkqwnsst------------------------------- 307
gi 358336121 253 gdliirvhrggsckpvkkpttsmwlssvaaqtssgeanepravgsnsysdvcssdraaceeialaspq-irtdscerpvs 331
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2494958   355 ----------------hshshshhhhhnhgggtttstpeepddeplsalhnnglarhrhmgknfslsrklakfAKEKKAA 418
gi 118402734 247 ------------------------------------eslvpyngavsngerlsqaandkklrqikiakrlqkfTKEHKAA 290
gi 94730443  328 tegchsdsisrssqrnfrgrnvtigsncsstllqvdqpdrmslssnsqmvmtsplstrrklnvreksrqmmryVHEQRAA 407
gi 291234542 333 ---------------------------------------aahaaygkkkggrglrrdgkgfvaltgrrmlsriSKEHKAA 373
gi 291244554 308 ---------------------------------------------------------ampvrrlhiskrfirlAKERKAA 330
gi 215501723 303 -----------------------------------nnyktvfstsnesfdrnnltgvsrnlknfslsrklaklAKERKAA 347
gi 321474780 275 ---------------------------lrihrggrvasdnrrcaaaaalltyqaanrhqlaidpsstrklakiAKERKAA 327
gi 405970916 305 -----------------------qsfekclseserdslvengkrhsdtsnhrptrcitkrirqfaiskkltkvAREQKAA 361
gi 360043110 308 --------wryeqnhftdyqcnnnkdkkylknhssvsnekcntsqieinslsktkcwinqlrefarkkcvckfAREQKAA 379
gi 358336121 332 vmkhvrfaklknsnhklekrsgcrcdcqtccgcasfvfrcrgrldpqdcsedeilqndrrprlfsfkkrinrfLQEKRAA 411
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                     #  ##  #                   #   #   #                     
gi 2494958   419 KTLGIVMGVFIICWLPFFVVNLLSgfcie---ciehEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAF 485
gi 118402734 291 KTLSIVIGVFILCWLPFFVLNIIIsacsf--qcidgVDFLYAIFTWLGYVNSGFNPIIYACSSMEFRRAF 358
gi 94730443  408 RTLSIVVGAFILCWTPFFVFTPLTafces---cfsnKETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAF 474
gi 291234542 374 KMLGIVMGVFELCWLPFFITNNILwavckt-dcvqyPHIVIPITAWLGYINSAFNPMIYARSSRGFKRAF 442
gi 291244554 331 KTLGIVMGVFIICWLPFFVLNVLYgicgd--vcvenADLLYNLFTWLGYLNSGVNPFIYAFSSRDFKRAF 398
gi 215501723 348 KTLAIVMGVFILCWLPFFVTNILMgicge--ncvmqPDLVFSTVTWLGWINSGMNPIIYACWSRDFRRAF 415
gi 321474780 328 KTLGIVMGVFIACWLPFFVTNLLSafcqs---cihnPERVVTVVTWLGWINSGMNPVIYACWSRDFRRAF 394
gi 405970916 362 KTLGIVVGVFILCWVPFFVFNILEgichd--kclthKDILFPLFTWLGYINSGMNPIIYALSMKDFRRAF 429
gi 360043110 380 KTLGIIMGLFILCWLPFFICNILIafnphslnqndgFKQAHILVTWLGYINSCINPIIYAHSMHEFRRAF 449
gi 358336121 412 KTLGIIMGVFIVCWLPFFVYNTLKsiqps--wtqshESILFPFLTWLGYVNSSINPFIYAYSLRDVRRGF 479

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap