4GRV,3ZEV


Conserved Protein Domain Family
7tmA_NTSR

?
cd15130: 7tmA_NTSR 
Click on image for an interactive view with Cn3D
neurotensin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors
Neurotensin (NTS) is a 13 amino-acid neuropeptide that functions as both a neurotransmitter and a hormone in the nervous system and peripheral tissues, respectively. NTS exerts various biological activities through activation of the G protein-coupled neurotensin receptors, NTSR1 and NTSR2. In the brain, NTS is involved in the modulation of dopamine neurotransmission, opioid-independent analgesia, hypothermia, and the inhibition of food intake, while in the periphery NTS promotes the growth of various normal and cancer cells and acts as a paracrine and endocrine modulator of the digestive tract. The third neurotensin receptor, NTSR3 or also called sortlin, is not a G protein-coupled receptor.
Statistics
?
PSSM-Id: 320258
View PSSM: cd15130
Aligned: 3 rows
Threshold Bit Score: 416.655
Threshold Setting Gi: 311033404
Created: 24-Jul-2013
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:peptide ligand binding site [polypeptide binding site]
Evidence:
  • Structure:4GRV: Rattus norvegicus neurotensin receptor Nts1 binds neurotensin peptide (8-13), contacts at 4A.
    View structure with Cn3D
  • Structure:3ZEV: Rattus norvegicus neurotensin receptor 1 binds agonist neurotensin, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                       #   ##           
4GRV_A        33 VLVTAIYLALFVVGTVGNSVTLFTLARKKSlqslqstVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGdagCRG 112
gi 311033404  33 VLFTALYALIWALGAAGNALSAHVVLKARAgra--grLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGdlgCRG 110
3ZEV_A        20 VLVTAIYLALFVVGTVGNSVTLFTLARKKSlqslqstVDYYLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGdagCRG 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #                                                             #                
4GRV_A       113 YYFLRDACTYATALNVASLSVARYLAICHPfKAKTLMsRSRTKKFISAIWLASALLAIPMLFTMGlqnrs---adgthPG 189
gi 311033404 111 YYFVHELCAYATVLSVAGLSAERCLAVCQPlRARSLLtPRRTRWLVALSWAASLGLALPMAVIMGqkheletadgepePA 190
3ZEV_A       100 YYFLRDACTYATALNVVSLSVELYLAICHPfKAKTLMsRSRTKKFISAIWLASALLAIPMLFTMGlqnls---gdgthPG 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          ####                                                                          
4GRV_A       190 GLVCTPivdtatVKVVIQVNTFMSFLFPMLVISILNTVIANKLtvmvnifemlrideglrlkiykdtegyytigighllt 269
gi 311033404 191 SRVCTVlvsrtaLQVFIQVNVLVSFVLPLALTAFLNGVTVSHLlalcsqvpststpgsstpsrlellseeg--------- 261
3ZEV_A       177 GLVCTPivdtatLKVVIQVNTFMSFLFPMLVASILNTVIANKLtvmvhqaaeq--------------------------- 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4GRV_A       270 kspslnaakseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagf 349
gi 311033404     --------------------------------------------------------------------------------
3ZEV_A           --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      ##
4GRV_A       350 tnslrmlnnkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdaygsgsVQALRHGVLVARAVVIAFVVCWLPYHVRR 429
gi 311033404 262 ------------------------llsfivwkktfiqggqvslvrhkdvrrIRSLQRSVQVLRAIVVMYVICWLPYHARR 317
3ZEV_A       230 ------------------------------------------grvctepgrVQALRRGVLVLRAVVIAFVVCWLPYHVRR 267
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|..
Feature 1          ## ###  #    #  #   #                             
4GRV_A       430 LMFCYISDEQWttflFDFYHYFYMLTNALAYASSAINPILYNLVSanFRQVF 481
gi 311033404 318 LMYCYVPDDAWtdplYNFYHYFYMVTNTLFYVSSAVTPLLYNAVSssFRKLF 369
3ZEV_A       268 LMFCYISDEQWttflFDFYHYFYMLTNALVYVSAAINPILYNLVSanFRQVF 319

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap