4PHU


Conserved Protein Domain Family
7tmA_FFAR1

?
cd15169: 7tmA_FFAR1 
Click on image for an interactive view with Cn3D
free fatty acid receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors
This subgroup includes the mammalian free fatty acid receptor 1 (FFAR1), also called GPR40. FFAR1 is a cell-surface receptor for medium- and long-chain free fatty acids (FFAs). The receptor is most potently activated by eicosatrienoic acid (C20:3), but can also be activated at micromolar concentrations of various fatty acids. FFAR1 directly mediates FFA stimulation of glucose-stimulated insulin secretion and indirectly increases insulin secretion by enhancing the release of incretin. Free fatty acid receptors (FFARs) belong to the class A G-protein coupled receptors and are comprised of three members, each encoded by a separate gene (FFAR1, FFAR2, and FFAR3). These genes and a fourth pseudogene, GPR42, are localized together on chromosome 19. FFARs are considered important components of the body's nutrient sensing mechanism, and therefore, these receptors are potential therapeutic targets for the treatment of metabolic disorders, such as type 2 diabetes and obesity.
Statistics
?
PSSM-Id: 320297
View PSSM: cd15169
Aligned: 3 rows
Threshold Bit Score: 437.133
Threshold Setting Gi: 665764643
Created: 15-Dec-2013
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 41 residues -Click on image for an interactive view with Cn3D
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               #  ##            ###### 
4PHU_A       19 QLSFGLYVAAFALGFPLNVLAIRGATAHARlrLTPSAVYALNLGCSDLLLTVSLPLKAVEALasgAWPLPasLCPVFAVA 98
gi 3122157    6 QLSFGLYVAAFALGFPLNVLAIRGATAHARlrLTPSLVYALNLGCSDLLLTVSLPLKAVEALasgAWPLPasLCPVFAVA 85
gi 81911832   6 QLFFALYVSAFALGFPLNLLAIRGAVARARlrLTPNLVYTLHLACSDLLLAITLPVKAVEALasgAWPLPlpLCPVFVLV 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1       ##  #                                            # #####                        
4PHU_A       99 HFAPLYAGGGFLAALSAARYLGAAFPLgYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEApggwldhsntslgintpvn 178
gi 3122157   86 HFFPLYAGGGFLAALSAGRYLGAAFPLgYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEApggwldhsntslgintpvn 165
gi 81911832  86 HFAPLYAGGGFLAALSAGRYLGAAFPFgYQAVRRPRYSWGVCVAIWALVLCHMGLVLGLEApggwlnttssslgintpvn 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                    #  ### ### ##                                                      
4PHU_A      179 gSPVCLEAWDPasAGPARFSLSLLLFFLPLAITAFCFVGCLRALargsnifemlrideglrlkiykdtegyytigighll 258
gi 3122157  166 gSPVCLEAWDPasAGPARFSLSLLLFFLPLAITAFCYVGCLRALar---------------------------------- 211
gi 81911832 166 gSPVCLEAWDPnsARPARLSFSILLFFVPLVITAFCYVGCLRALah---------------------------------- 211
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
4PHU_A      259 tkspslnaakseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvag 338
gi 3122157      --------------------------------------------------------------------------------
gi 81911832     --------------------------------------------------------------------------------
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                #  ## #
4PHU_A      339 ftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdaygsLTHRRKLRAAWVAGGALLTLLLCVGPYNAS 418
gi 3122157  212 ------------------------------------------------sgLTHRRKLRAAWVAGGALLTLLLCVGPYNAS 243
gi 81911832 212 ------------------------------------------------sgLSHKRKLRAAWAAGGAFLTLLLCLGPYNAS 243
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....*.
Feature 1       #  #      ## ###  #  ##                       
4PHU_A      419 NVASFLypnlGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVC 464
gi 3122157  244 NVASFLypnlGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVC 289
gi 81911832 244 NVASFVnpdlGGSWRKLGLITGSWSVVLNPLVTGYLGASPGRGTVC 289

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap