Conserved Protein Domain Family
7tmA_CCK_R

?
cd15206: 7tmA_CCK_R 
cholecystokinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors
Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.
Statistics
?
PSSM-Id: 320334
View PSSM: cd15206
Aligned: 8 rows
Threshold Bit Score: 391.754
Threshold Setting Gi: 161077941
Created: 25-Sep-2008
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative peptide ligand binding pocket [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                #  ##           ###### #
gi 2495001    69 WVRIVMYSVIFLLSVFGNTLIIIVLVMNKRlRTITNSFLLSLALSDLMVAVLCMPFTLIPNLmenFIFGeviCRAAAYFM 148
gi 416772     42 AVQILLYSLIFLLSVLGNTLVITVLIRNKRmRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLlkdFIFGsavCKTTTYFM 121
gi 379133553  55 VASICLYMIVFCMAMVGNILVVVTLALNPRmRTVTNCFLLSLAVSDLLLAVCCMPVSLVGQIlkrFIFGevlCKAIPYFM 134
gi 38677993   91 GLIIALYSVVFILAAVGNILVLVTLISNRRmRTVTNCFLISLSLSDLLQALVCMPISLIGQIlkrFVFGsvmCKVLPYFM 170
gi 482678622  53 ELIIPLYAIIFVLSIVGNSLVLVTLVRNKRmRTVTNVYLLNLAISDLLLGVFCMPFTLVGQVlrnFIFGatmCRLIPYFQ 132
gi 443686137  46 EIRIPLYCLIFILSLVGNILVIMTLVQNKKmRTVTNVFLLNLSVSDLLLTVFCMPFTLVPTLlrnFIFGqemCILIRYIQ 125
gi 405962837  62 ETAAVCYAVIFVLALVGNILVIATLVQNKRmRTVTNVFLLNLSFSDLLLAVFCMPFNIIPMLmrnFVFGptvCYLSRYFQ 141
gi 161077941 112 VWLIPSYSMILLFAVLGNLLVISTLVQNRRmRTITNVFLLNLAISDMLLGVLCMPVTLVGTLlrnFIFGeflCKLFQFSQ 191
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 2495001   149 GLSVSVSTFNLVAISIERYSAICNPlkSRVWQtrsHAYRVIAATWVLSSIIMIPYLVYnktvtfpm-kdrrvghQCRLVW 227
gi 416772    122 GTSVSVSTFNLVAISLERYGAICKPlqSRVWQtksHALKVIAATWCLSFTIMTPYPIYsnlvpftk-nnnqtanMCRFLL 200
gi 379133553 135 AASVSVSTFTLLALSLERYSSICHPlkSRVWQtrkHAIKVICGIWISSFILVSPTLVFsnlsnipivkigrcspACRMTF 214
gi 38677993  171 GISVSVSTFTLLALAIERYNAICNPlkSRGWQtksHAYKVIAIIWTISFLIMSPFLVFsklrymplvkqgkctlACRLYF 250
gi 482678622 133 AVSVSVGVWTLVAISLERYFAICRPlkSRRWQtqfHAYKMIAVVWLASLFWSAPVLAVsslkam-----kgrghKCREEW 207
gi 443686137 126 AVTVAVSVFTLVSISLERYFAICQPlrSRSWQtlsHSYKTIAGVWVLCLGTMVPIAVYqkhipl-----kggrhKCIEVI 200
gi 405962837 142 GVSVGVSSFTLVAISLERYFAICRPlqSRKWQtlsHAYRSILLIWGVAFVIMIPIPVHtnyenk-----rpgmyRCREKW 216
gi 161077941 192 AASVAVSSWTLVAISCERYYAICHPlrSRSWQtisHAYKIIGFIWLGGILCMTPIAVFsqlipt----srpgycKCREFW 267
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                              #  ### ### ##                             
gi 2495001   228 Psk---------------------------------qvQQAWYVLLLTILFFIPGVVMIVAYGLISRELyrgiqfemdln 274
gi 416772    201 Pnd---------------------------------vmQQSWHTFLLLILFLIPGIVMMVAYGLISLELyqgikfeasqk 247
gi 379133553 215 Pnr---------------------------------itNQAWYLFLLVSMFCIPGVVMIMTYTKICWDIlnrfkldssfr 261
gi 38677993  251 Gge---------------------------------qaRQAWYVLQIVFLFCIPGLVMTVAYTCVCLKIsegfqfetkek 297
gi 482678622 208 Psk---------------------------------ssEQIFNLFLDAMLLLIPVLIMSLAYSLIMTKLwkglrreiqhn 254
gi 443686137 201 IlccfcvgeisviahinsanllsscknnylgvslahiaERTYTIILDLMLLVLPLILMLAAYGLISWTLwngmkvdmrsr 280
gi 405962837 217 Eae---------------------------------ivERIYTVFLVLMLLVIPLIAMSVAYGIVMHTLyeditvsretn 263
gi 161077941 268 Pdq---------------------------------gyELFYNILLDFLLLVLPLLVLCVAYILITRTLyvgmakdsgri 314
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2495001   275 keakahkngvstpttipsgdegdgc------------------------------------------------------- 299
gi 416772    248 ksakerkpsttssgkyedsdgcy--------------------------------------------------------- 270
gi 379133553 262 ntaggrlgsssdyvpaactsngdgicvssprlpcdskvmgsp-------------------------------------- 303
gi 38677993  298 kpkksfpmnmnicmrrvrgesngnrnvskteedcgkk------------------------------------------- 334
gi 482678622 255 nsfqaqmiqrsnssptingelnkstspqstsepsgmnhlrptnrllppshnkahsrvkdakhskktesvkmwfmkgivqv 334
gi 443686137 281 qdikelrhinqnedpdtddeht---------------------------------------------------------- 302
gi 405962837 264 glnrprhsesirslenssfrkf---------------------------------------------------------- 285
gi 161077941 315 lqqslpvsattaggsapnpgtssssncilvltatavynensnnnngns-------------------------------- 362
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2495001   300 -------------------------------------yiqvtkrrntmemstltpsvctkmdrarinnseakLMAKKRVI 342
gi 416772    271 --------------------------------------lqktrpprklelrqlstgsssranrirsnssaanLMAKKRVI 312
gi 379133553 304 -------------------stvnspaiarvngeflqpsavtmlvkssecntspfllrskreqneranralarWKAKKRVI 364
gi 38677993  335 ------------------------tqpllivqsddgtnrlqvpdkssngrqlsvrksnrkrcdsrslqtesqLLAKKRIV 390
gi 482678622 335 rlpasikkgytcntqtkstlvprcelttpssehcsynelcpsndasyatssvdettyhftrhairsnymdksIEAKKKVI 414
gi 443686137 303 ---------------------------------------ryetcqengnrrygtkkrhevrqgmrqnntersLQAKRRVI 343
gi 405962837 286 ---------------------------------------lgnggdglsstestphkrpeqrcmirhsnpernRAAKVRVI 326
gi 161077941 363 -------------egsagggstnmatttlttrptaptvitttttttvtlaktsspsirvhdaalrrsneaktLESKKRVV 429
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
Feature 1                     #  ## ##  #           ## ###  #  ##                     
gi 2495001   343 RMLIVIVAMFFICWMPIFVANTWKAFdelsafntlTGAPISFIHLLSYTSACVNPLIYCFMNkRFRKAF 411
gi 416772    313 RMLIVIVVLFFLCWMPIFSANAWRAYdtasaerrlSGTPISFILLLSYTSSCVNPIIYCFMNkRFRLGF 381
gi 379133553 365 QMFIVIVVLYFVCWTPLYVINAWRAFepkr-amfaLEGSIHIVHLLSYISTCVNPIVYCFMNkRFRDSF 432
gi 38677993  391 KMLIVIVVLFFVCWTPLFIVNVWKAFdpkg-arkiFSGVIEIIQLMSYISTCVNPVTYCFMNkRFREGF 458
gi 482678622 415 RMLFVVVAEFFICWAPLHILNTWYLFypedvylyvGSTGISLVQLLAYISSCCNPITYCFMNrKFRQAF 483
gi 443686137 344 KMLFVVVLEFFVCWTPMYVLQTWSLFdwdnaqkhvSPVTMNLIHLLAYASSCTNPITYCFMNqKFRKCF 412
gi 405962837 327 RMLFAVVIEYFICWTPMYAVQTWKSFhepsltqyfSNLTLSLVYMLAYLSSACNPVTYCLMNkSFRQSF 395
gi 161077941 430 KMLFVLVLEFFICWTPLYVINTMVMLigpvvyeyvDYTAISFLQLLAYSSSCCNPITYCFMNaSFRRAF 498

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap