Conserved Protein Domain Family
7tmA_OR8S1-like

?
cd15229: 7tmA_OR8S1-like 
olfactory receptor subfamily 8S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor 8S1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320357
View PSSM: cd15229
Aligned: 37 rows
Threshold Bit Score: 393.886
Threshold Setting Gi: 301621038
Created: 4-Dec-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                #  ##           ###### #
gi 296439256  25 ALLFVLFLGIYLLTIMENLMLLLMIRADSClhkpMYFFLSHLSFVDLCFSSVIVPKMLENLlsqrKTISVegCLAQVFFV 104
gi 395841738  25 ALLFVLFLVIYLLTIMGNLLLLLLIRTDSHlhtpMYFFLSHLSFVDLCFSSVTVPKMLQNLlsqrKTISVegCLTQVFFV 104
gi 521032866 193 VVLFVLFLVIYLLILTENLLMLLVIRADSHlhtpMYFFLSHLSFLDAFYSSIVVPKLLENLlskwKTISLlgCFTQVSLV 272
gi 395541341  31 YALGFLFLLIYFLTLAGNLLIMAVIKMDSQlhtpMYFFLVNLSFFDMFYSSVMAPKLVYTLltknKTVSLsgCVVQIGLM 110
gi 301621038  23 FPLFLVFLLIYLITLTGNLLILLLIFTDSHlhtpMYFFLGTLACLDMSYSSVTVPRMLFDLlrerKIISVpaCITQICFF 102
gi 564235506  25 IFLFLVFLIIYIITLLGNVVIMLVIRTDPHlhtpMYFFLSNLSFLDICYSSVTVPKMLVNFlverKTISLsgCTTQLFFV 104
gi 637331452  27 IFLFLIFLLIYIITLSGNVLIMLVIKADPQlhtpMYFFLTNLSLIDICFSSVTVPKMLENLlateKTISLssCIAQIFFF 106
gi 512870736  25 LPLFVLFLLIYLMTLVGNLLILLMICTDSHlhtpMYMFLSNLAGLDIFYSTVTSPRMLSDFfsktKTITLpvCITQFFFF 104
gi 440897618  14 TMLFVLFLGIYLLTLMGNLMMILVIRADPHlhtpMYFFLGHLSFLDICHSSITIPKMLQNFlsqrKTLSVwgCITQSFFF 93
gi 530645301  25 IFLFLVFLAIYLITLLGNMMIMLVIWADHHlhtpMYFFLSNLSFLDICYSSVTVPQMLESFlaekKTISVhgCIAQLFFF 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 296439256 105 FVTAGTEACLLSGMAYDRHAAICRPllYGQIMgKQLYMHLVWGSWGLGFLDALINVLLavnMVFCEAKIIHHYsYEMPSL 184
gi 395841738 105 FVAAGTEACLLSVMAYDRYAAICHPllYGQIMsKQLYMYLAWGSWALGFLDALINILLavnMVFCGPNLVRSFaCELPPV 184
gi 521032866 273 IFSGATEACLLSVMAYDRFQAVCHPllYMVAMdKKVCTGLVGASWAIGMGSSLVNTLLlaqQNFCGPNFIHSFvCELPPV 352
gi 395541341 111 FFIASSEAFILSAMAYDHYSAICNPliYVIVMsKRFCTFLARGSCLLEVTNSLMNTLPllrLHFCGPHLIHHYsCEMPEL 190
gi 301621038 103 IFFALSEAFVLAVMSYDRYIAICRPlhYMLLMsWKVCVKLVSGVLVFGAVHSLVHTVFltkLTFCRPDVLQSFfCDLPQL 182
gi 564235506 105 IFFIVAEGLLLSVMAYDRYAAICHPlhYTTIMkQWVHVQLACGAWITAFLYAFPNTLLlmrLHFCGPNIINHFsCEPPQV 184
gi 637331452 107 IFMVGTEIFLLSAMAYDRYAAICHPlrYSTIIsRQACSQMVLGAWISGFVDSLVNTLFltgLHFRNRGSINHFsCELPLL 186
gi 512870736 105 FSFICIELYLLAAMSYDRYVAICHPlhYIQIMhPKFCAMMVSVAWAGGFLTSLIHTLCtlrLTFCGPNLIQGFfCDLPQL 184
gi 440897618  94 IFSGGTESCLLSAMAYDRYAAICHPllYTMIMnGPLCTAMVSAAWVMGFLSSLVNNLCtqnLQFCGPNIISHFsCELPSL 173
gi 530645301 105 FFLATTECYLLAIMAYDRYTAICEPlnYLKMMsEPVCMWMAGGAWIAGLLNSLVNTLLvtdLHFCGQKEINHFcCELPVL 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #  ### ### ##                                            #  ## ##  #  
gi 296439256 185 LPLSCSDisrSLIALLCSTLLHGLGNFLLVFLSYTRIISTIlsisstSGRSKAFSTCSAHLTAVTLYYGSGLLRHLMPn- 263
gi 395841738 185 LLLACSDphaSIASMLTTMVVLGLSNIILLLGSYSRIITTAlrvnsaAGRSKIFSTCSSHFLVLVIFYGSGCSRYMTPa- 263
gi 521032866 353 LLLACSDshmSIASILTTVGVLGFGTLVLLLGSYTRIIMTAlrinsaMGRSKIFSTCSSHVLVVTIFYGSGVFRYMTPa- 431
gi 395541341 191 LPLSCSDlfpNKMILFTTLVVFGFGCFFPILFSYTRIISAIlkissaSGRSKAFSTCSSHVIVVTLFFLTGLGRHLSPa- 269
gi 301621038 183 LQISCSDtfiNVLLIFCFGTLFGVIILAITFYPYITIIRTVlkipsqNMRSKAFSTCSSHLTVVFIFYGSFFFNYLRPna 262
gi 564235506 185 FMLSCSDpfaNRMVVYTVGITLGLLAFLITLSSYVNIISTIlkmssvEGKHKAFSTCTSHLIVLILFYGSVMVKYLKPtt 264
gi 637331452 187 LQLSCTStfaNEMVILTFSMALGFASLLLIIASYVRIISTVlkiqsaDGRQKAFSTCTSHLMVVLLFCGTAFIRYMRPas 266
gi 512870736 185 FALSCTNtfvNVLVMFLVGIFMGSGALGITFVPYIHIFRTIkkiktwRGKLKAFSTCASHLTVVFVFYGTLIFTYLRPtp 264
gi 440897618 174 FPLSCSDtmpNTILLAGSTAFLGLVTLPPILFSYSKIILAIlsisssKGQGKAFSTCSSHLTVVLSFYGTALFRYISPs- 252
gi 530645301 185 LPLSCTDtfiNEMVLFAFTIILGMLSLLLTLISYMFIISTIlripskEGRCKAFSTCTSHLIIVGLFYGTGLISYIRTds 264
                        250       260       270
                 ....*....|....*....|....*....|....*..
Feature 1           ## ###  #  ##                     
gi 296439256 264 -SGSPIELIFSVQYTVVTPMLNSLIYSLKNKEVKGER 299
gi 395841738 264 -SGSALEQVLSVQYSVVTPMLNPLIYSLKNQEVKTAL 299
gi 521032866 432 -SGSVLEQVLSMQYSVVTPLLNPLIYSLKNQEVKAAL 467
gi 395541341 270 -TGSILEQVISLQYSIVTPLLNPIIYSLKNVEVKIAI 305
gi 301621038 263 kYRFTEDKVASVFYATLTPFLNPLIYSLRNQELQISL 299
gi 564235506 265 sHSQDRDKFISLAYSIFTPMLNPIIYSLRNQEVKKAV 301
gi 637331452 267 sYSETVDKLVSVQYSILTPMLNAIIYSLKNKEVKKAI 303
gi 512870736 265 rNGFSEDRLVSVVYTVVTPILNPIIYSLRNKDLKEAF 301
gi 440897618 253 -SGSVLERVVSIQYGVITSLINPLIYSFKNQEVKAAL 288
gi 530645301 265 sYSLTLEKVVSIQYSVLTPMFNPIIYSLKNNEVKSSV 301

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap