Conserved Protein Domain Family
7tmB2_GPR113

?
cd15253: 7tmB2_GPR113 
orphan adhesion receptor GPR113, member of the class B2 family of seven-transmembrane G protein-coupled receptors
GPR113 is an orphan receptor that belongs to group VI adhesion-GPCRs along with GPR110, GPR111, GPR115, and GPR116. The adhesion receptors are characterized by the presence of large N-terminal extracellular domains containing multiple adhesion motifs, which play critical roles in ligand recognition as well as cell-cell adhesion and cell-matrix interactions, linked by a stalk region to a class B seven-transmembrane domain. GPR113 contains a hormone binding domain and one EGF (epidermal grown factor) domain, and is primarily expressed in a subset of taste receptor cells. In addition, almost all adhesion receptors, except GPR123, contain an evolutionarily conserved GPCR-autoproteolysis inducing (GAIN) domain that undergoes autoproteolytic processing at the GPCR proteolysis site (GPS) motif located immediately N-terminal to the first transmembrane region, to generate N- and C-terminal fragments (NTF and CTF), which may serve important biological functions. However, several adhesion GPCRs, including GPR 111, GPR115, and CELSR1, are predicted to be non-cleavable at the GAIN domain because of the lack of a consensus catalytic triad sequence (His-Leu-Ser/Thr) within their GPS.
Statistics
?
PSSM-Id: 320381
View PSSM: cd15253
Aligned: 6 rows
Threshold Bit Score: 408.38
Threshold Setting Gi: 637372002
Created: 11-Nov-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative polypeptide ligand binding pocket [polypeptide binding site]
Evidence:
  • Comment:based on mutagenesis of human glucagon receptor (GCGR), and modeling studies of GCGR and other related class B GPCRs
  • Comment:Residues in the globular N-terminal extracellular domain and the extracellular loops of the 7TM domain may also be involved in ligand binding.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                #   #                                               #  ##  #        #    
gi 59797951   767 EPALALLTQVGLGASILALLVCLGVYWLVWRVVVRNKISYFRHAALLNMVFCLLAADTCFLGAPFLSpgprspLCLAAAF 846
gi 637372002  608 SAALTVLSTVGLCASVVALMATLLIYYLVWTSVVKNKVSYFRYTTLANLAFSLLLASLCFLTASRLTaghespLCVAAAF 687
gi 345322840  631 RSSLTLLSQVLLGASVLALLLCLGMYRAVWHVVIRNKVSYFRHAALVNVVFCLLAADICFLGASLLPsspqspLCLTVAF 710
gi 641775616  233 SFWLDFLSQFGVCASILALILCLGIYYLVWRLVVRNKISYFRYMTLVNIALSLLMANAWFLGSTWMTpsheneLCVAATF 312
gi 564228544  690 GFWLSFLSQLGVCASIAALLLCLSIYRLAWPTVVRSKVSYFRYMTLVQICLSLLLGNLWFVGGARLAaegwgeLCMAAAF 769
gi 512871008  293 LLFIDEITYAGLGASILSLCVCIITECLVWKSVVRNNISYFRHISLVNIAVSLLFADTLFFAATFPSvtnykfICLSITF 372
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #                                                                           ##
gi 59797951   847 LCHFLYLATFFWMLAQALVLAHQLLFVFHqlakhRVLPLMVLLGYLCPLGLAGVTLGLYLPQGQYlregeCWLdgKGGAL 926
gi 637372002  688 FCHFFYLATFFWMLVQALMLFHQLVFVFHrlsmsAVAPAMLALGYLCPLAIAAATVAAAFPARQYlqeglCWLsaRSKAL 767
gi 345322840  711 LCHFLYLATFFWMLAQALVLAHQLLFVFHqlskrRVLPLMITLGYLCPLGLAAATLGKYFPQGQYlkkgtCWLdaEGGAQ 790
gi 641775616  313 FTHFFYLAMFFWMLVQALMLFHHLVFVFHqlaraSVTPLLVTIGYLCPLLIAAADITIYYPKRGYvqataCWLngHNGAI 392
gi 564228544  770 FMHFFYLATFFWMLVQAXMIFHQLVFVFHqlaraSVTPFMVTVGYLCPLAIAVATVAVYQPRQQYlhptaCWLsgYSGAV 849
gi 512871008  373 LNHFFYLALFFWTFCQSVMLLHQLLFVFHhlrkrIFLSLSFFVGYFIPALIAAGTFLYFYPKNTYlhqsvCWLnpESGAI 452
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          # #                                                       #  #               # 
gi 59797951   927 YTFVGPVLAIIGVNGLVLAMAMLKLLRPSLSEGPpaekrqALLGVIKALLILTPIFGLTWGLGLATLLEe---vSTVPHY 1003
gi 637372002  768 YAFSIPVLAIVAVNLAVLVVVLMKLMRPSVSEAPpgeerwALVGLFKALLVLTPVFGLTWGLGVITMTGq---aSPATHY 844
gi 345322840  791 YLFVVPVLTIVGVNAVVLALALLKLTRPTPSEGPrpeerhALMSIFKALLILTPVFGLTWGLGLANLMEe---iSEVPHY 867
gi 641775616  393 YAFSVPVLVIVLVNVLILFVVVMKLMRPSLSEGPkgeerkTLISILKALLILTPIFGLTWGLGVITMTSk---sSDLSHY 469
gi 564228544  850 YAFSGPVLLVVLANLLILFVVVMKLMRPSVSEGPpaddrkALLGILKALLVLTPVFGLTWGLGAATMAGd---sSRGSHY 926
gi 512871008  453 YTFAIPAGSIIMFNFMTLMVVISKLSRPSVSEANrpedreTAKSIMKAVLVLTPVFGLTWSFGFALLKDldsltRQIFTY 532
                         250       260       270
                  ....*....|....*....|....*....|....
Feature 1           #                               
gi 59797951  1004 IFTILNTLQGVFILLFGCLMDrKIQEALRKRFCR 1037
gi 637372002  845 AFTLLNAFQGVFILIFGCLMD-RKIAHLHGLSCD 877
gi 345322840  868 LFVVFNASQGIFILLFGCLMDkKMREALLKRLGC 901
gi 641775616  470 VFAALNSFQGVSILVFGCLMDkKVRDALLERIQK 503
gi 564228544  927 TFSILNSLQGVFILVFGCLLDkKVREALLRRLHK 960
gi 512871008  533 GFAGLNAFQGFFILLTCLTEK-KVRDALTNKVSS 565

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap