Conserved Protein Domain Family
7tmB1_VIP-R1

?
cd15269: 7tmB1_VIP-R1 
vasoactive intestinal polypeptide (VIP) receptor 1, member of the class B family of seven-transmembrane G protein-coupled receptors
Vasoactive intestinal peptide (VIP) receptor 1 is a member of the group of G protein-coupled receptors for structurally similar peptide hormones that also include secretin, growth-hormone-releasing hormone (GHRH), and pituitary adenylate cyclase activating polypeptide (PACAP). These receptors are classified into the subfamily B1 of class B GRCRs that consists of the classical hormone receptors and have been identified in all the vertebrates, from fishes to mammals, but are not present in plants, fungi, or prokaryotes. For all class B receptors, the large N-terminal extracellular domain plays a critical role in peptide hormone recognition. VIP and PACAP exert their effects through three G protein-coupled receptors, PACAP-R1, VIP-R1 (vasoactive intestinal receptor type 1, also known as VPAC1) and VIP-R2 (or VPAC2). PACAP-R1 binds only PACAP with high affinity, whereas VIP-R1 and -R2 specifically bind and respond to both VIP and PACAP. VIP and PACAP and their receptors are widely expressed in the brain and periphery. They are upregulated in neurons and immune cells in responses to CNS injury and/or inflammation and exert potent anti-inflammatory effects, as well as play important roles in the control of circadian rhythms and stress responses, among many others. VIP-R1 is preferentially coupled to a stimulatory G(s) protein, which leads to the activation of adenylate cyclase and thereby increases in intracellular cAMP level. However, depending on its cellular location, VIP-R1 is also capable of coupling to additional G proteins such as G(q) protein, thus leading to the activation of phospholipase C and intracellular calcium influx.
Statistics
?
PSSM-Id: 320397
View PSSM: cd15269
Aligned: 4 rows
Threshold Bit Score: 493.987
Threshold Setting Gi: 2495069
Created: 11-Nov-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative polypeptide ligand binding pocket [polypeptide binding site]
Evidence:
  • Comment:based on mutagenesis of human glucagon receptor (GCGR), and modeling studies of GCGR and other related class B GPCRs
  • Comment:Residues in the globular N-terminal extracellular domain and the extracellular loops of the 7TM domain may also be involved in ligand binding.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              #   #                                         #  ##  #                 # 
gi 21264544 138 YGTVKTGYTIGHTLSLIALTAAMIILCLFRKLHCTRNYIHMHLFMSFIMRAIAVFIKDVTLFESgepeh-cfvssVGCKA 216
gi 82175575 126 FGAIKTGYTIGHSLSLISLTAAMIILCIFRKLHCTRNYIHMHLFMSFIMRAIAVFIKDIVLFESgesdh-chvgsVGCKA 204
gi 267355   140 YNTVKTGYTIGYSLSLASLLVAMAILSLFRKLHCTRNYIHMHLFMSFILRATAVFIKDMALFNSgeidh-cseasVGCKA 218
gi 2495069  100 FRSVKIGYTIGHSVSLISLTTAIVILCMSRKLHCTRNYIHMHLFVSFILKAIAVFVKDAVLYDViqesdncstasVGCKA 179
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            #                                                                       ## 
gi 21264544 217 MMVFFQYCVMANFFWLLVEGLYLHTLLVisffserKYFWWYILIGWGAPSVFITAWTVVRIyffnvGCWEei-iESPIWW 295
gi 82175575 205 AMVFFQYCIMANFFWLLVEGLYLHNLLVisffsekKYFWWYILIGWGAPSVFITAWSLARVyfedtGCWDt--iESHLWW 282
gi 267355   219 AVVFFQYCVMANFFWLLVEGLYLYTLLAvsffserKYFWGYILIGWGVPSVFITIWTVVRIyfedfGCWDti-iNSSLWW 297
gi 2495069  180 VIVFFQYCIMASFFWLLVEGLYLHALLAvsffserKYFWWYILIGWGGPTIFIMAWSFAKAyfndvGCWDiienSDLFWW 259
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1       # #                                                       #  #            #   # 
gi 21264544 296 IIKTPILVSILVNFILFICIIRILVQKLHSPDVGhnetsQYSRLAKSTLLLIPLFGIHYIMFAFFPDNfkAQVKLVFELV 375
gi 82175575 283 IIKTPILVSILVNFILFICIIRILVQKLHSPDVGrnensQYTRLAKSTLLLIPLFGVHYIMFAFFPDNfkVEVKLVFELI 362
gi 267355   298 IIKAPILLSILVNFVLFICIIRILVQKLRPPDIGkndssPYSRLAKSTLLLIPLFGIHYVMFAFFPDNfkAQVKMVFELV 377
gi 2495069  260 IIKTPILASILMNFILFICIIRILRQKINCPDIGrnesnQYSRLAKSTLLLIPLFGINFIIFAFIPENikTELRLVFDLI 339
                       250       260       270
                ....*....|....*....|....*....|
Feature 1                                     
gi 21264544 376 VGSFQGFVVAVLYCFLNGEVQAELKRKWRR 405
gi 82175575 363 LGSFQGFVVAVLYCFLNGEVQAELKRKWRR 392
gi 267355   378 VGSFQGFVVAILYCFLNGEVQAELRRKWRR 407
gi 2495069  340 LGSFQGFVVAVLYCFLNGEVQAEIKRKWRR 369

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap