Conserved Protein Domain Family
7tmA_mAChR_M5

?
cd15300: 7tmA_mAChR_M5 
muscarinic acetylcholine receptor subtype M5, member of the class A family of seven-transmembrane G protein-coupled receptors
Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. M5 mAChR is primarily found in the central nervous system and mediates acetylcholine-induced dilation of cerebral blood vessels. Activation of M5 receptor triggers a variety of cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320427
View PSSM: cd15300
Aligned: 3 rows
Threshold Bit Score: 373.208
Threshold Setting Gi: 6601553
Created: 4-Jul-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence similarity to Human M2 muscarinic acetylcholine bound an antagonist (3-quinuclidinyl-benzilate), contacts at 4A.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       #
gi 543761     31 ITIAAVTAVVSLITIVGNVLVMISFKVNSQlktvNNYYLLSLACADLIIGIFSMNLYTTYILmgrWALGslaCDLWLALD 110
gi 6601553    31 ITIAAVTAVVSLITIVGNVLVMISFKVNSQlktvNNYYLLSLACADLIIGIFSMNLYTSYILighWSLGslaCDLWLALD 110
gi 190337474  26 IAIATVSAIVSFITIIGNILVMLSFKVNSQlktvNNYYLLSLAFADLIIGVFSMNLYTSYILmgyWALGslaCDLWLALD 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  ##                                              #                            
gi 543761    111 YVASNASVMNLLVISFDRYFSITRPltYRAKRtPKRAGIMIGLAWLISFILWAPAILCWqylvgkrtvpldECQIQflsE 190
gi 6601553   111 YVASNASVMNLLVISFDRYFSITRPltYRAKRtPKRAGIMIGLAWLISFILWAPVILCWqyfvgertvppeECQIQflyE 190
gi 190337474 106 YVASNASVMNLLVISFDRYFSITRPltYRAKRtPKRAGIMIGLAWLVSFILWAPPILCWqyfvgkrtvperQCQIQffsE 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #  ##  ##                                                                    
gi 543761    191 PTITFGTAIAAFYIPVSVMTILYCRIYRETekrtkdladlqgsdsvtkaekrkpahralfrsclrcprptlaqrernqas 270
gi 6601553   191 PTITFGTAIAAFYIPVSVMTILYCRIYKETekrtkdlaelqgsesvaefetikprkaflkscfsckqqnlvkrercqasw 270
gi 190337474 186 PVITFGTAIAAFYFPVSVMTILYCRIYKETerrtkdlaelqginsstnssgdaqpqkirscfgckhvsntsrtqalshtn 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 543761    271 wsssrrststtgkpsqatgpsanwakaeqlttcssypssededkpatdpvlqvvyksqgkespgeefsaeeteetfvkae 350
gi 6601553   271 ssssrstsatvkasqaastctewakadqlttcssyasseeedklatdpvfqvayr----spskgkeeefneresqdivvk 346
gi 190337474 266 aaktlddqltnfnsyasseeedrsgnfqescrhqen------------------------------------------ks 303
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 543761    351 teksdydtpnyllspaaahrpksqkcvaykfrlvvkadgnqetnngchkvkimpcpfpvakepstkglnpnpshqmtkrk 430
gi 6601553   347 eqpeendfetqqyflspahrpkskkcvaykfrlvvkadgtqeanngcrkvkitpcsaalskdpsiksmdpninnqttkrk 426
gi 190337474 304 esyeeenffptpvkasptktkkcvsykfkpkdvsplkntngdakpgassfssaesvnapsssssskpidgtlkcqitkrk 383
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
Feature 1                                #  ##                     #  ##                     
gi 543761    431 rvvlVKERKAAQTLSAILLAFIITWTPYNIMVLVStfcdkcvPVTLWHLGYWLCYVNSTVNPICYALCNrtFRKTF 506
gi 6601553   427 rmvlIKERKAAQTLSAILLAFIITWTPYNIMVLVStfcsdciPLTWWHLGYWLCYVNSTVNPMCYALCNktFRKTF 502
gi 190337474 384 rmvlIKEKKAAQTLSAILLAFILTWTPYNIMVLIStfcsdciPLSLWHLGYWLCYVNSTVNPMCYALCNktFQKTF 459

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap