Conserved Protein Domain Family
7tmA_mAChR_DM1-like

?
cd15301: 7tmA_mAChR_DM1-like 
muscarinic acetylcholine receptor DM1, member of the class A family of seven-transmembrane G protein-coupled receptors
This subgroup includes muscarinic acetylcholine receptor DM1-like from invertebrates. Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. In general, the exact nature of these responses and the subsequent physiological effects mainly depend on the molecular and pharmacological identity of the activated receptor subtype(s). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320428
View PSSM: cd15301
Aligned: 5 rows
Threshold Bit Score: 373.774
Threshold Setting Gi: 316976757
Created: 4-Jul-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence similarity to Human M2 muscarinic acetylcholine bound an antagonist (3-quinuclidinyl-benzilate), contacts at 4A.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       #
gi 328790631  34 VLIVIIALFLSLTTVVGNIMVMISFKIDKQlqtiSNYFLFSLAVADFAIGLISMPLFTVYTVlgyWPLGphiCDTWLALD 113
gi 55977774  105 VVMGFVAAILSTVTVAGNVMVMISFKIDKQlqtiSNYFLFSLAIADFAIGAISMPLFAVTTIlgyWPLGpivCDTWLALD 184
gi 55977887   66 VMIVVIGAMFALVTSLGNLMVMVSFKIDKQlqtiSNYFLFSLAVADIAIGVISIPMFTYYTAiqkWDLGytmCQFWLCID 145
gi 215493382  48 ILIAILAALLSTLTIIGNLMVMISFKLDKQlqtiSNYFLLSLAIADFSIGVISMPLFTMYTLydhWPLGtfiCDTWLAFD 127
gi 316976757  63 LAIVIVGFVLSLVTTGGNVLVIMSFKMDKQlqtiNNYFLLSLAVADLVVGCVSIPLMTVYTAsgsWPLGyevCQLWLNID 142
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  ##                                              #                            
gi 328790631 114 YLASNASVLNLLIISFDRYFSVTRPltYRAKRtTSKAAIMIACAWGISLLLWPPWIYAWPYiegqrtvpinACYIQFiet 193
gi 55977774  185 YLASNASVLNLLIISFDRYFSVTRPltYRAKRtTNRAAVMIGAAWGISLLLWPPWIYSWPYiegkrtvpkdECYIQFiet 264
gi 55977887  146 YLMSNASVLNLLLISFDRYFSVTRPlsYRPRRtTKKALTMIACTYIISLILWPPWIISWPYiegkftaepgTCVVQFlqt 225
gi 215493382 128 YLTSNASVLNLLIISFDRYFSVTRPltYRARRtTKRAAIMIASAWVISLVLWPPWIYSWPYiegrrsvpvdRCYIQFlet 207
gi 316976757 143 YLVSNTSVLNLLLISFDRYLSVTRPltYRPRRtRVKAIVMITSTFIISLLIWPPWIIAWPYiegkf-ipagTCIVQFlit 221
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            #  ##  ##                                                                   
gi 328790631 194 NHYITFGTAIAAFYVPVTVMIILYWRIWKETKKRQKdlpylqagkqdaskrsnssdealdmedcrrprsesstgvedvna 273
gi 55977774  265 NQYITFGTALAAFYFPVTIMCFLYWRIWRETKKRQKdlpnlqagkkdsskrsnssdentvvnhasggllafaqvggndhd 344
gi 55977887  226 NPYVTVGTAVAAFYLPVTIMCILYTRVYWETQKRQKefgklqatqtwasdvvdrpstqsfrnskmwkkvkkfsrrsmkrd 305
gi 215493382 208 NIYVTFGTALAAFYVPVTVMCILYWRIWRETEKRQKdltqlqagkkdgsrkstssddpaesedfrrgrsdscapdvetty 287
gi 316976757 222 NPYVTLGTACAAFYVPVTIMVILYAQVYNVTKRRSEeikklqgfhkksmcfirgnrataqlqfhshhrnppshhsnhnhh 301
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 328790631 274 thiavsylekhypqyktkhrpfswmwlkmwciawwhsgredddeeediegaessrathgydeaitplsaetpltgtvsrs 353
gi 55977774  345 twrrprsesspdaesvymtnmvidsgyhgmhsrkssikstntikksytcfgsikewciawwhsgredsddfayeqeepsd 424
gi 55977887  306 vsstsiikssgsmrkknnqdgyvedsvtpctssrnskrkswlrnctgksnsssedsseavamnlddtslssshfalsgsr 385
gi 215493382 288 vptslcvetskylppavpkrrrlkdvllswcridndkedddstshggspgtqtpasvetpvqsasmtfradqlvqln--- 364
gi 316976757 302 rhhchlqlqsslehpttapvqlppsviiqtsgicepqhqqhqqtsqnahycdqsvpksaapssprlgkriryflkqskre 381
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 328790631     --------------------------------------------------------------------------------
gi 55977774  425 lgyatpvtietplqssvsrctsmnvmrdnysmggsvsgvrppsillsdvsptplprpplasisqlqemsavtasttanvn 504
gi 55977887  386 rrni---------------------------------------------------------------------------- 389
gi 215493382     --------------------------------------------------------------------------------
gi 316976757 382 cqlsknstrryshpenrrllkmsssyvenerrsfnppplhqpvlgkvfsegehcqla----------------------- 438
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 328790631     --------------------------------------------------------------------------------
gi 55977774  505 tsgngngainnnnnashngngavngngagngsgiglgttgnathrdsrtlpvinrinsrsvsqdsvytilirlpsdgass 584
gi 55977887  390 ------------------------------------------------------------------------------sp 391
gi 215493382     --------------------------------------------------------------------------------
gi 316976757 439 -------------------------ypsfanisssgmsscesedgfsfgksdvleimaelekrsedndvddeqscdevee 493
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 328790631 354 -aslsgihpttltveraisiadnhdykksgkagelstksissdsvytilirlptrdtsgmgkysegpsikmyhdetvsps 432
gi 55977774  585 naangggggpgagaaasaslsmqgdcapsikmihedgptttaaaaplasaaatrrplpsrdsefslplgrrmshaqhdar 664
gi 55977887  392 pctpmptnfedeeqtdagasmrngsarfrsrpsdtgknnnsdtytvlielndegsrpsvrlsscepyldepistrnrsks 471
gi 215493382 365 ----pagrqvsipmtdrnglrrsdrpstsrsyssdsvytilirlptqpsleggasqasikmileedaeknettttfarts 440
gi 316976757 494 ivgesaevdadigivdetlskhqqldeqhqqhldqeqleqleheqqriilpkqhrsstfsikteqkssltdgvgstgypa 573
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                         #  ##          
gi 328790631 433 mitrrpshmpdiriplntknipkalgskpaankttnkkkkklqekKADRKAAKTLSAILLAFIITWTPYNILVLIKsita 512
gi 55977774  665 llnakvipkqlgkagggaagggvggahalmnarnaakkkkksqekRQESKAAKTLSAILLSFIITWTPYNILVLIKpltt 744
gi 55977887  472 dcnseiderrhsllnkqspfkngrilknfssqerksekeqrknerKQESKAAKTLSAILCAFIATWTPYNLIVCWEaffp 551
gi 215493382 441 sedsttlrtaeagidtiriplntklvhrqvakqkapkkkrkqqerKQEKKAAKTLSAILLAFIVTWTPYNVLVLIKtvss 520
gi 316976757 574 spsrptlshmipsfltmtiggstganirsklmklnqnirfaaklrRSESKAAKMLSVILLAFIVTWTPYNVIVLIEaffp 653
                        650       660       670
                 ....*....|....*....|....*....|....*....
Feature 1                     #  ##                     
gi 328790631 513 cswyiPQELWDFFYYLCYINSTVNPMCYALCNaaFRRTY 551
gi 55977774  745 csdciPTELWDFFYALCYINSTINPMCYALCNatFRRTY 783
gi 55977887  552 --ntvPNVLWTFSYFLCYINSTINPLCYALCNarFRHTY 588
gi 215493382 521 cddciPTGLWNFVYYLCYINSTVNPLCYALCNanFRRTY 559
gi 316976757 654 --qtvPSYFFKLSYYLCYLNSTINPLCYALCNraFRRTY 690

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap