Conserved Protein Domain Family
7tmA_mAChR_GAR-2-like

?
cd15302: 7tmA_mAChR_GAR-2-like 
muscarinic acetylcholine receptor GAR-2 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. In general, the exact nature of these responses and the subsequent physiological effects mainly depend on the molecular and pharmacological identity of the activated receptor subtype(s). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320429
View PSSM: cd15302
Aligned: 7 rows
Threshold Bit Score: 331.707
Threshold Setting Gi: 21431740
Created: 4-Jul-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence similarity to Human M2 muscarinic acetylcholine bound an antagonist (3-quinuclidinyl-benzilate), contacts at 4A.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 345482196  119 VLIALALGICIVLTVGGNILVLLAFIVDRTir-qpSNYFIASLAATDMLIGTVSMPFYTVYVLmg-yWDLGpllCDLWLS 196
gi 24644966   134 ILIAICLAICIILTVGGNILVLLAFIVDRNir-qpSNYFIASLAATDMLIGTVSMPFYTIYVLkg-yWDLGpmlCDLWLS 211
gi 21431739     6 VLLALFMLFLSIVTVIGNLAVLLSYYLDKNir-qpTNYFIFSLAISDLLIGLEGIPVYTAFYLnnneWIWGdvlCDLWLS 84
gi 21431740    25 IVVWIIIIVLSLETIIGNAMVVMAYRIERNiskqvSNRYIVSLAISDLIIGIEGFPFFTVYVLngdrWPLGwvaCQTWLF 104
gi 316974568  187 IILGMITASLSIITVVGNLMVMISFYIDKNir-qpSNYFIFSLAVSDFLIGLEGFPLYSIYVLngqkWTMGwflCDLWLS 265
gi 353232037  151 VILALLTAIVSFITIVGNILVLISFFVERAlr-taSNYFIASLAVTDVLIGFFSMNFYTLYLLlg-rWPLGrlsCDLWLS 228
gi 443718491    8 IFLGSLASFTSLMTIFGNTVVILSFVLERQir-qpTNYFIASLAVSDLLIGSISMPFYTVYLLageyWPLGefvCDMWLS 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          ##  ##                                              #                          
gi 345482196  197 VDYTVCLVSQYTVLLITIDRFCSVKIAakYRSWRtKNRVIWMVTITWIIPALLFFISIFGWehfvgy-rdlapgQCAVQF 275
gi 24644966   212 VDYTVCLVSQYTVLLITIDRYCSVKIAakYRSWRtRTRVIYMVTITWIIPALLFFISIFGWehftgk-rdllpgQCAVQF 290
gi 21431739    85 IDYIVCLASIYTVLGITVDRYYSVKKPatYRNWRtPGRVVLIIIFIWLVPSILFSVSIFGYgtftgtgrilketECYVQF 164
gi 21431740   105 LDYTLCLVSILTVLLITADRYLSVCHTakYLKWQsPTKTQLLIVMSWLLPAIIFGIMIYGWqamtgqstsmsgaECSAPF 184
gi 316974568  266 VDYSACLASTYTVLFITIDRYCSVKIPttYRNWRtQRKVLVIIAITWLVPTLLFFISVFGWgyfsgqgrvlaehECMVQF 345
gi 353232037  229 LDYTACLTSQYTVLIITIDRFCSVRIPakYRNWRtERKILILVAVTWIIPSSVFFTTIMGWpyfhtdgnprpddECYAEF 308
gi 443718491   87 TDYTLCMTSIYTVFCITIDRYCSVKIPakYRNWRtDRKVLIIIMATWIIPIGVFFTSIFGWqyfvgr-rsvpegKCFVQY 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1               #  ##  ##                                                                 
gi 345482196  276 lkDPVFNTALIIGYYWTTLIVLFILYGGIYKTAydmqkkseakqrkmqsmvalsagamsgmagraagigisktqstllsq 355
gi 24644966   291 lkDPIFNTALIIGYYWTTLIVLFVLYAGIYKTAydmqkrseakqrkmqsmvalsagamsgmaghaagigvieekilktkv 370
gi 21431739   165 mtNPYLNMGMYISYYWTTLFVMLYLYWGIYRAAkklalksdqktkrlalltemrrpevsvrtsdagnsssdspndtsnss 244
gi 21431740   185 lsNPYVNMGMYVAYYWTTLVAMLILYKGIHQAAknlekkakakerrhialilsqrlgtqvgvslmlqskaekekaeeaqk 264
gi 316974568  346 mvDPYFNMSMYISYYWSTLIVMIILYAGIYRAArnlhlkskqkrqrfqaicalratttpltmksstlkeeddssqitpeh 425
gi 353232037  309 atDPIFNTVFTVCYFWVTLCVMLVLYVGIYRVAadlqkrsdekrnrvsglitnniqnnkttthmllnnqrasshgvnqkt 388
gi 443718491  166 meEALFNCILQVGYFWITLIIMCILYTGIYRVAltlqaksdakhkkmtslvsmaersrrgpllprerqqtgtatsgsspd 245
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 345482196  356 dkpkaqatiagtttntttntatttttesenqpaaseprqhqaasatkspgkslgrqlepllpsaaqdqekserssspafd 435
gi 24644966   371 elagdqtdldsacttvikrlsgsgqanplavateevekmtpeqrrasaakiqeeakkreaavdaekserssspafdsdee 450
gi 21431739   245 kcfrtapptttvqttqtnvgtpppvfrnhmtlhnnnmdftkdneivrpptppddntysnpnfsmiseqltngfsrqepss 324
gi 21431740   265 dsgytsnqagdannlrrfgfsepetsqfrvdpnsnnnlnvegslntendqnlgvieeersgflsrresnesyypgphpta 344
gi 316974568  426 segssgaqhaktpagtsavakssrnhtsakqsssaaakgkallpavnnissssacstdesdaakmqnkvqpsdssqsqyd 505
gi 353232037  389 tnnhnypynssigglgdssgfdsdegetpidsdyqnrvmeqfkqrmaalgnqkttprvtdh------------------- 449
gi 443718491  246 agtkqgtsstsfsssrnnekeedrsssptfpsdtdpssnspkrspkttk------------------------------- 294
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 345482196  436 sdeesttgpaaatasqqlsqlrkrsslaglvaqsgalqvfapnaringilpvkvemnlpmaaaalatgkrlsptspvrep 515
gi 24644966   451 ssvnqaqqlitqqklnnmrkrssiglvfgaqaallatrgkgnlqksttnsksieamhqyhhhqqhhhnqsplqraqskee 530
gi 21431739   325 vierestapcvspepshaslenefnenhhahfkpelslpfidads----------------------------------- 369
gi 21431740   345 ansrrcsemekvsllsesdgvpstrpaksygrlslrsrysasesittthendekevekadslqklfaddelgsvlnfke- 423
gi 316974568  506 nmpkekkeealcenldnlipleksvsfmnetnnscnsppngdvpnpkstamsvilkrnrlsepechvvlaeeamkatkrn 585
gi 353232037      --------------------------------------------------------------------------------
gi 443718491      --------------------------------------------------------------------------------
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 345482196  516 prlqalpkiqeaslldaenpsepaersspgdmtltpelslaerageeapttdhrrsaaaaqpescpkdstsssshiippp 595
gi 24644966   531 mrslhhhqnqqqphhqhhqnqpnppldrpkrtscstlsqiaehdrlvdlsapptllntsdplspvdlapievpsdqvhqg 610
gi 21431739       --------------------------------------------------------------------------------
gi 21431740       --------------------------------------------------------------------------------
gi 316974568  586 lslnfnriadidsdypsl-------------------------------------------------------------- 603
gi 353232037      --------------------------------------------------------------------------------
gi 443718491      --------------------------------------------------------------------------------
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 345482196  596 sefrgspan-------------------ltdnttsstssslsvdsrqqrsvfvtadglqgavtydimtgldgadlrymde 656
gi 24644966   611 lvqtilpppdafqcptplsddysdrpfgnssgnselaltydlmtnselrymdessamlasvtansttspndsvqgkppvl 690
gi 21431739       --------------------------------------------------------------------------------
gi 21431740       --------------------------------------------------------------------------------
gi 316974568      --------------------------------------------------------------------------------
gi 353232037      --------------------------------------------------------------------------------
gi 443718491      --------------------------------------------------------------------------------
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 345482196  657 ssvivpspsyesppssfscslanplstapsspilgpapplgnpsllqaaliratvqqvpsrtvaqtsnassqthpprvfi 736
gi 24644966   691 ppppparrnppksnlnqslsqtpsqnqspsqslslnlnpnhnqsqsqsieeavaiekrllvsytgiedfakvrresciea 770
gi 21431739   370 -------------------------------------------------------------------------vssmvgh 376
gi 21431740   424 ---------------------------------------eklkntdsnndsdttsvilqrsrkykknkrprssrrsehst 464
gi 316974568  604 --------------------kspeefffldialketvspkslspsasgsvrmdqeptllyanaastlpyvdanvkpqsdn 663
gi 353232037      --------------------------------------------------------------------------------
gi 443718491      --------------------------------------------------------------------------------
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 345482196  737 thqsnaasqtspvvmnklntevsvrhedapkkqpvtsiiastattptpptldssscggcqpsplpstsattvvnqpvtpv 816
gi 24644966   771 iclldvpgklaadcphrrasspmetsskdailyspmppmplspkvktstpqtgtpqsaagvtppvplerieeretsdsnt 850
gi 21431739   377 ddlrramsirisrsvsmqgtaratpvieivenleealkicenleelredenkneeekqknglenggmnhviiandeqqps 456
gi 21431740   465 prqiakvkqaegtaaqlieesvpdddqtetievkrtdrwvvsmkkriaralirrrsttrpergsssnsddsssevegeek 544
gi 316974568  664 dhnstepncqvaslaknecawetileispermskiaqpksndikqesdeedfsshrniiknagiiyehegherrwtfgrf 743
gi 353232037  450 ---------------------------------------------------------tkvnnppsnqsllkckqannhsr 472
gi 443718491  295 --------------------------------------------------------------------kskkmkknstca 306
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 345482196  817 qqekqpekthqelkklsskrdtescatvtcsdtggggggggggggngtggggsrrdlvkaigkrlkaktqkkdptlgrqk 896
gi 24644966   851 nkmpstsgttsstggvggggeqdgvgatkknagdddanreekslaasrnsskrafihsigkhfkskkalplilgvggrqk 930
gi 21431739   457 tskeseqkeemtpenhdpnevkvpliavsrvesvkstaggkvrrlitqmrshsirskrkanknksvlsalnffqrkkeyk 536
gi 21431740   545 pevrnnglkipqltvnnenrgetssqpgrdrlappnktdtflsasgvsrkististvitrekvissifapiavfnrgrkq 624
gi 316974568  744 qirweyhpgffqkspkvkkpveskedtndeakksdtmtadtakllphaglvqaskatvsrlfgrmptrqagssnslmyrk 823
gi 353232037  473 ltlntsnfsestsskvvcdekclcysqdfdnrktslnisvgarllfyvqsiklkvnkesivehvkktfirrkskhknier 552
gi 443718491  307 aamvrrdsfansdqksddassvgslnslpdtppidtlptpvvvspavnvqvttttdskcvqsvlarvedaaplngsdiep 386
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                 #  ##                           #  ##                   
gi 345482196  897 srteNRARKAFRTISFILGAFVACWTPYHILALVEgfcrn----ppctNEHLFMFSYFLCYANSPMNPFCYALANqqFKK 972
gi 24644966   931 skseNRARKAFRTISFILGCFVACWTPYHVLALVEgfcrh----ppciNEHLYMFSYFLCYANSPMNPFCYALANqqFKK 1006
gi 21431739   537 srseNRARKALRTITFILGSFIILWTPFYVLATIYgfcetc--kaspsFNTLYTISYYLCYMNSPLNPFCYAMANqqFKK 614
gi 21431740   625 tkaeKRAHKAFRTITFIVGFFAILWSPYYIMATVYgfck-----geciPSFLYTLSYYMCYLNSSGNPFAYALANrqFRS 699
gi 316974568  824 skseNRARKALRTITVILGAFVAFWTPFYVLATIYgfce------dcvPKTVYVVSYYLCYMNSPINPFCYALANvqFKK 897
gi 353232037  553 grreNRARKALRTITFIMGAFVICWTPYHIVIMIKgicddiqkkytcvNDIFYSVTYWLCYMNSPINPFCYALANaqFKK 632
gi 443718491  387 akneNRALKALRTITIILGAFVLCWTPWHILSMIMsicta---pegcvEPVLYNISYYLCYLNSPINPLCYAFANqqFKK 463

                  ..
Feature 1           
gi 345482196  973 TF 974
gi 24644966  1007 TF 1008
gi 21431739   615 TL 616
gi 21431740   700 AF 701
gi 316974568  898 TL 899
gi 353232037  633 TF 634
gi 443718491  464 TF 465

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap