Conserved Protein Domain Family
7tmA_5-HT2_insect-like

?
cd15307: 7tmA_5-HT2_insect-like 
serotonin receptor subtype 2 from insects, member of the class A family of seven-transmembrane G protein-coupled receptors
The 5-HT2 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the central nervous system (CNS). The 5-HT2 subfamily is composed of three subtypes that mediate excitatory neurotransmission: 5-HT2A, 5-HT2B, and 5-HT2C. They are selectively linked to G proteins of the G(q/11) family and activate phospholipase C, which leads to activation of protein kinase C and calcium release. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in diseases such as migraine, schizophrenia, and depression. Indeed, 5-HT2 receptors are attractive targets for a variety of psychoactive drugs, ranging from atypical antipsychotic drugs, antidepressants, and anxiolytics, which have an antagonistic action on 5-HT2 receptors, to hallucinogens, which act as agonists at postsynaptic 5-HT2 receptors. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 320433
View PSSM: cd15307
Aligned: 3 rows
Threshold Bit Score: 361.192
Threshold Setting Gi: 45331303
Created: 28-Jul-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence similarity to Human 5-HT2B receptor.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                    #  #
gi 193917035  83 NYWALLALVLVFGTAAGNILVCLAIAWERRlqnvTNYFLMSLAITDLMVAVLVMPLGILTLVkghFPLSsehCLTWICLD 162
gi 45331303   73 NWWGLVALLVVLLTLFGNILLILAISWDRRlqnmTNYFLLSLAVTDLMVASLVMPLSIVVLIlghFPFSselCLLWISLD 152
gi 320542529  74 NYWALLALVLVLGTAAGNILVCLAIAWERRlqnvTNYFLMSLAITDLMVAVLVMPLGILTLVkgyFPLGsehCLTWICLD 153
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  ##                                                                  #      ##
gi 193917035 163 VLFCTASIMHLCTISVDRYLSLRYPMRFGRNKtRRRVTLKIVFVWLLSIAMSLPLSLMYSkdhasvlVNGTCQIPDPVYK 242
gi 45331303  153 VLFCTASIMHLCTLSVDRFLSLRYPMKFGRHKtRRRVVLKIVLVWCLSLAASLPLSLMYAtdphstiVDGVCQIPVSLFQ 232
gi 320542529 154 VLFCTASIMHLCTISVDRYLSLRYPMRFGRNKtRRRVTLKIVFVWLLSIAMSLPLSLMYSknhasvlVNGTCQIPDPVYK 233
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          #   #                                                                         
gi 193917035 243 LVGSIVCFYIPLGVMLLTYCLTVRLLARQRqnlgggqptsavtpgwasgwlgqapalerrctwrrllkpgqshastvlha 322
gi 45331303  233 IIGSVICFYIPLIIMLVTYALTARLLSKKQselqstvleapsaspsprsirwkkllckttsnlststavsitdgdisdsg 312
gi 320542529 234 LVGSIVCFYIPLGVMLLTYCLTVRLLARQRqnlgggqqtaaatpgwasgwlgqapalerrctwrrllkpgpgnassvlha 313
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 193917035 323 hsanstdtdlstldnhelwlpdssipeptpttmtalhqfgaemlklsrglesvasssttgsptksefsisnnlpyssspq 402
gi 45331303  313 crldtrceegklrrfgssplrrpplvrytshhyraallrgggcgargyssrdlkgdgsgagvedrlfphlptspayelsv 392
gi 320542529 314 hsanstdtdlstldnhelwlpdssikeptpttmtalhqfgaemlklsrglesvasssttgsptksefslsnhlqlqypss 393
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 193917035 403 rfsthqqqqqhnqqqqqqqqqqhqqhlqhahgssylqqtspkgkqssnilglssttlglerestrnslassrmgeqsdgt 482
gi 45331303  393 fpqgpcsaptstttsplhrshhdaddhsqletnpeerggpkgsqvhapspsceqng------------------------ 448
gi 320542529 394 pqryaathqqshhhnhqqhpagvyhqqaspkgrhgttvlglstttlgierestrnslassrmggeqsdgtlsqlsqrlra 473
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 193917035 483 lsqlsqrlraykkrrrassaasgrerragsedaededqdtlrrckrynslpknalythhktlhesqddddneaagaeped 562
gi 45331303      --------------------------------------------------------------------------------
gi 320542529 474 ykkrrrassavpgrekraghedadedvetptstlrrhkrhnslpknalyprhttvqesldd------------------- 534
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 193917035 563 dderldtqaaktsksssmskschsdtevepqqgklyhvpsssnhqsdypqlpsvctcpyfgdrplqscvktaevkiissa 642
gi 45331303      --------------------------------------------------------------------------------
gi 320542529 535 ----------dddeeeesaqqkdqqtkskichsdteldppqkakqchiagqnhqsdylqlpsvctcpyfgdrplqncvks 604
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 193917035 643 fkvttvttatavssspsemdlllcsasnnksaltgsvsvgaaaaavpgggvggasantlspnsahqtpgscltvhsdgsg 722
gi 45331303  449 --------------dprrrgaaeecseeceggdsssshvavpcscaprffledikassdsqceectdprphemeapyrnh 514
gi 320542529 605 aevkiissafrvtttttavssspsemellmcssgnkksltssvsagitggpagaapatvgstlsphsahnqgssltvqsd 684
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 193917035 723 flaapgtpcpgrrklsisktasvvtwdssrhrrrgssfggartsllltptktasstatttttttplrrsatlrshqnmny 802
gi 45331303  515 qrrrsqesrqrqegrgrgccpeeesgwccpclrtrltlrrqngsqgaevplsspwhegaspprttpdlvtrtalrsggqv 594
gi 320542529 685 gsgylaapgtpcpgrrklsisktasvvtwdssrhrrrgssfggvrtsllltptktattsnsstplrrsatlrshqnmnyq 764
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                           #  ##  #  #  
gi 193917035 803 qgggeggksrtphsspcllqrqqtvrshhsrnssvisrnsSRHGRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPtv 882
gi 45331303  595 ttllhkagstdsssvgalpsssrglwrqrscsasikyvssKRHGRNIRMEQKATKVLGVVFFTFVLLWAPFFIANVLIsc 674
gi 320542529 765 gagecggktrtttsspcmlqrqqtvrshhsrnssvisrnsSRHGRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPtv 844
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|....*....
Feature 1                 #  ##  #   #                            
gi 193917035 883 caeceeriSHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCR 931
gi 45331303  675 g----ahiEGEMINLVTWLGYASSMVNPFFYTFFNKTFRQTFLKILKCQ 719
gi 320542529 845 caeceeriSHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCR 893

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap