3PBL


Conserved Protein Domain Family
7tmA_D3_dopamine_R

?
cd15310: 7tmA_D3_dopamine_R 
Click on image for an interactive view with Cn3D
D3 subtype of the D2-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors
Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. Activation of D2-like family receptors is linked to G proteins of the G(i) family. This leads to a decrease in adenylate cyclase activity, thereby decreasing cAMP levels. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.
Statistics
?
PSSM-Id: 320436
View PSSM: cd15310
Aligned: 4 rows
Threshold Bit Score: 431.316
Threshold Setting Gi: 49900834
Created: 28-Jul-2013
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 27 residues -Click on image for an interactive view with Cn3D
Feature 1:TM helix 1 [structural motif]
Evidence:
  • Comment:All members of this receptor family contain a seven-transmembrane helix domain.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ###########################                                                    
3PBL_A        39 AYYALSYCALILAIVFGNGLVCMAVLKERAlqttTNYLVVSLAVADLLVATLVMPWVVYLEVtggvWNFSricCDVFVTL 118
gi 1169206    30 AYYALSYCALILAIVFGNGLVCMAVLKERAlqttTNYLVVSLAVADLLVATLVMPWVVYLEVtggvWNFSricCDVFVTL 109
gi 49900834   34 NYYAMLYSLLILAIVFGNVLVCIAVLRERAlqttTNYLVVSLAVADLLVASLVMPWAVYLEVvggaWLFSrlyCNVFVTL 113
gi 238625781  34 AYYALCYCILILAIIFGNVLVCLAVLRERTlqttTNYLVVSLAVADLLVATLVMPWVVYLEVtggvWTFSricCDVFVTM 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3PBL_A       119 DVMMCTASIWNLCAISIDRYTAVVMPvhyqhgtgqssCRRVALMITAVWVLAFAVSCPLLFGFnttgdptVCSIsNPDFV 198
gi 1169206   110 DVMMCTASILNLCAISIDRYTAVVMPvhyqhgtgqssCRRVALMITAVWVLAFAVSCPLLFGFnttgdptVCSIsNPDFV 189
gi 49900834  114 DVMMCTASILNLCAISIDRYTAVVMPvlynt--thssRKRVSVMIATVWVLAFAVSCPLLFGFnttddpaVCSIsNPDFV 191
gi 238625781 114 DVMMCTASILNLCAISIDRYTAVVKPvqyqyntgqssCRRVSLMIVVVWMLAFAVSCPLLFGFnttgdpsVCSIsNPVFI 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3PBL_A       199 IYSSVVSFYLPFGVTVLVYARIYVVLkqrrrknifemlrideglrlkiykdtegyytigighlltkspslnaakseldka 278
gi 1169206   190 IYSSVVSFYLPFGVTVLVYARIYVVLkqrrrkriltrqnsqcnsvrpgfpqqtlspdpahlelkryysicqdtalggpg- 268
gi 49900834  192 IYSSVVSFYLPFAVTLLVYVRIYIFLrrrrkkitfrqgsgkvqpasappsvetclqddahkekrdlspirinviteskeq 271
gi 238625781 194 IYSSLVSFYLPFMVTLLLYVRIYLVLrqrqkkrtlsrqcsysastkpcythkehnkrktlpnrcqdpfspclqlkcsdqe 273
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3PBL_A       279 igrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrmlqqkrwdea 358
gi 1169206   269 --------------------------------------------------------------fqerggelkreektrnsl 286
gi 49900834  272 virprllanclrrkrpqtapaens-------------llppvitlnycsisqasfarteqdanreeeeggdeeqvavrgc 338
gi 238625781 274 mstkrkllta------------------------------------------fslqqyrsfcqdrslsetpgtpqhnrle 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3PBL_A       359 avnlaksrwynqtpnrakrvittfrtgtwdaygvpLREKKATQMVAIVLGAFIVCWLPFFLTHVLNthcqtchvSPELYS 438
gi 1169206   287 sptiapklslevrklsngrlstslklgplqprgvpLREKKATQMVAIVLGAFIVCWLPFFLTHVLNthcqtchvSPELYS 366
gi 49900834  339 evkklangrthtslrppraahamvcpsqarcrsmhSKEKKATQMLAIVLGVFLICWLPFFVTHILNthcrachiPPEVYS 418
gi 238625781 312 errksknpglevqrlsngktvsslklahqqprliqLRERKATQMLAIVLGTFIVCWMPFFLIHILNahcpachvPPGLYS 391
                        410       420
                 ....*....|....*....|....*...
Feature 1                                    
3PBL_A       439 ATTWLGYVNSALNPVIYTTFNieFRKAF 466
gi 1169206   367 ATTWLGYVNSALNPVIYTTFNieFRKAF 394
gi 49900834  419 AFTWLGYVNSALNPVIYTTFNieFRRAF 446
gi 238625781 392 ASTWLGYVNSALNPIIYTTFNtdFRRAF 419

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap