Conserved Protein Domain Family
7tmA_alpha2C_AR

?
cd15323: 7tmA_alpha2C_AR 
alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G protein-coupled receptors
The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.
Statistics
?
PSSM-Id: 320446
View PSSM: cd15323
Aligned: 5 rows
Threshold Bit Score: 462.869
Threshold Setting Gi: 20141211
Created: 8-Jul-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                   #   #
gi 231464     52 AGLAAVVGFLIVFTVVGNVLVVIAVLTSRAlrapQNLFLVSLASADILVATLVMPFSLANELmayWYFGqvwCGVYLALD 131
gi 20141211   52 AGLAAVVGFLIVFTVVGNVLVVIAVLTSRAlrapQNLFLVSLASADILVATLVMPFSLANELmayWYFGqvwCGVYLALD 131
gi 68052369   36 IGLAGLVSFLILFTIVGNVLVVIAVLTSRAlkppQNLFLVSLASADILVATLIIPFSLANELmgyWFFGevwCNIYLALD 115
gi 449270793  11 ASLAAVVGFLIVFTIVGNVLVVIAVLTSRAlrapQNLFLVSLASADILVATLVMPFSLANELmnyWYFGkawCNIYLALD 90
gi 170284938  32 WCLAAIVGFLIIFTIVGNVFVVIAVLTSRAlkapQNLFLVSLASADILVAALVMPFSLANELmgyWYFGnvwCDIYLALD 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  ##                                                                   #      #
gi 231464    132 VLFCTSSIVHLCAISLDRYWSVTQAveYNLKRTPRRVKATIVAVWLISAVISFPPLVSFyrrpdgaayPQCGLNdETWYI 211
gi 20141211  132 VLFCTSSIVHLCAISLDRYWSVTQAveYNLKRTPRRVKATIVAVWLISAVISFPPLVSLyrqpdgaayPQCGLNdETWYI 211
gi 68052369  116 VLFCTSSIVHLCAISLDRYWSVTQAveYNLKRTPRRVKGMIVVVWLISAVISFPPLISMdrntvderrPMCQLNdHTWYI 195
gi 449270793  91 VLFCTSSIVHLCAISLDRYWSVTQAveYNLKRTPRRIKAIILTVWLISAVISFPPLISMyrdpegdvfPQCKLNdETWYI 170
gi 170284938 112 VLFCTSSIVHLCAISLDRYWSVTQAveYNLKRTPRRIKGIIVTVWLISAVISFPPLISMdrdteddvyPQCKLNdDTWYI 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          ##  #                                                                         
gi 231464    212 LSSCIGSFFAPCLIMGLVYARIYRVAKlrtrtlsekrgpagpdgaspttenglgkaagenghcapprtevepdessaaer 291
gi 20141211  212 LSSCIGSFFAPCLIMGLVYARIYRVAKlrtrtlsekrapvgpdgaspttenglgaaagagenghcapppadvepdessaa 291
gi 68052369  196 LYSSIGSFFAPCVIMILVYIRIYQVAKtrtrnmsekrrdpdggsgtprlenglsredsrrenghcssspgerkpaednpd 275
gi 449270793 171 LSSCIGSFFAPCLIMVLVYIRIYRVAKlrtrtlsekrtmpegssqtenglsraaggctslrmqlgenghysmhhwrkase 250
gi 170284938 192 LSSCIGSFFAPCIIMILVYIRIYQVAKlrtrtlsekkptrdgsshtengfskgttvkmpgdkenghcpprpsppkatdve 271
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 231464    292 rrrrgalrrggrr----regaegdtgsadgpgpglaaeqgartasrspgpggrlsrassrsvefflsrrrrarssvcrrk 367
gi 20141211  292 aerrrrrgalrrggrrragaeggaggadgqgagpgaaesgaltasrspgpggrlsrassrsvefflsrrrrarssvcrrk 371
gi 68052369  276 adledssss------------dekakrsqnetapskkdrrssrknsssskhssrksrassksldlfssrrkrrntisrkk 343
gi 449270793 251 ledieleesst--------sesrrrrsreehprkssksrsfsysysskhsssrlsrssnrsmqffsyrrrrkrssicrkk 322
gi 170284938 272 dleleessmse---------skrrkssskedntdsskerkcskgnsfskqssrlsrtsnksmelfssrkkkkrssvsrrk 342
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
Feature 1                               #  ##  #                #   #   #                     
gi 231464    368 vaqAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYgicreacqlPEPLFKFFFWIGYCNSSLNPVIYTVFNqDFRRSF 444
gi 20141211  372 vaqAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYgicreacqvPGPLFKFFFWIGYCNSSLNPVIYTVFNqDFRRSF 448
gi 68052369  344 isqAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYgicrepcaiPDPLFKFFFWIGYCNSSLNPVIYTIFNqDFRRAF 420
gi 449270793 323 vtqAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYgicreacevPETLFKFFFWIGYCNSSLNPVIYTIFNqDFRRSF 399
gi 170284938 343 lsqAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYgicreacevPETLFKFFFWIGYCNSSLNPVIYTIFNqDFRRSF 419

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap