Conserved Protein Domain Family
7tmA_alpha-2D_AR

?
cd15324: 7tmA_alpha-2D_AR 
alpha-2 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G protein-coupled receptors
The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.
Statistics
?
PSSM-Id: 320447
View PSSM: cd15324
Aligned: 5 rows
Threshold Bit Score: 410.031
Threshold Setting Gi: 47213063
Created: 29-Jul-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                   #   #
gi 68052355   31 AIIILVVSLIILLTIVGNVLVIVAVLTSRAlrapQNLFLVSLACADILVATLVIPFSLANEImgyWYFGstWCAFYLALD 110
gi 47213063   12 ICIVLVVTIIILGTVVGNVLVVVAVFTSRAlrapQNLFLVSLASADILVATLVIPFSLANEVmgyWYFGstWCSLYLALD 91
gi 68052354   34 VLIVLVVTVIILVTIVGNVLVVVAVFTSRAlrapQNLFLVSLAAADILVATLVIPFSLANEVmgyWYLGstWCAFYLALD 113
gi 21322670   34 ALIVLVVVVIVSVTIVGNVLVIVAVLTSRAlrapQNLFLVSLASADILVATLVIPFSLSNEVmgyWYFGstWCAFYLALD 113
gi 512829486  34 TLIIIAVVSIILSTVLGNILVVLAIFTSRAlrapQNLFLVSLASADILVGALIIPFSLAREVmgyWHFGsvWCSMYLALD 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  ##                                                                           
gi 68052355  111 VLFCTSSIVHLCAISLDRYWSVTKAvrYNLKRTPRRIKCMIAVVWLISAVISFPPLIMTkhd-------------ekECL 177
gi 47213063   92 ILFCTSSIVHLCAISLDRYWSVTKAvsYNRKRTPKRIKAMISIVWLISIVISSPPLLMTqkeealtrvegesatqwqECL 171
gi 68052354  114 VLFCTSSIVHLCAISLDRYWSVTKAvsYNLKRTPRRIKIMITVVWVISAVISFPPLLMTkhd-------------elECL 180
gi 21322670  114 VLFCTSSIVHLCAISLDRYWSVTKAvsYNLKRTPKRIKGMIAVVWIISAVISFPPLLLTkhd-------------erKCL 180
gi 512829486 114 ILFCTSSIVHLCAISIDRYWSVTKAvkYNLKRTPKRIKRSIAIIWVVSAIISFPPLLKSkhk-------------ewECL 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #      #  ##  #                                                                 
gi 68052355  178 IndETWYILSSCAVSFFAPGLIMITVYCKIYRVAKqrsstvfvaknglerqpsqsetcfvrkdkfekespssnssesaqr 257
gi 47213063  172 LisQTWYILSSCLVSFFAPGLIMILVYCKIYRVAKqrastvfvaknamerqpsqsetcfvaagrtcrrssnkaqraadgp 251
gi 68052354  181 LnnETWYILSSCIVSFFAPGLIMILVYCRIYRVAKqrastvfvakngmerqpsqsetcfvrkgksevespsshssgsrer 260
gi 21322670  181 LtdETWYILSSCVVSFFAPGLIMILVYFKIYKVAKqrsstvfvaknglerqpsqsetcfvrkdgfemespssqssgtpqq 260
gi 512829486 181 LndDTWYVLFSCTVSFFVPCLIMILLYCRIYRVAKhrvsslrngvsdcnsaaaggtcethhtiqnnheaeeldleestss 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 68052355  258 qeelddidlee----------------------saasdsrargsrfskrrrvegerrgpqrscrvswaahqepgsrqqql 315
gi 47213063  252 qpadhgaegdgghrheelddidleekscevdakptlstalrfprraaggacedgkdahqlkppapppsciswasrnrqas 331
gi 68052354  261 kgelddidleess------------------vsnrhrnsrfaksrkvegaqscpkpngrlswacsraseleqeprarqls 322
gi 21322670  261 rqgelddidleescg-------------asdtkarthrfskrrkvegsencppqncrmswassrasqlypeqknpggrqq 327
gi 512829486 261 vh----------------------------------------kfpkkhhhktkdkpssakakrlswssnrgqqhrdqsic 300
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    #  ##  #                #   #   #                   
gi 68052355  316 askskvaqMREKRFTFVLAVVMGVFVLCWFPFFFTYSLQavcgercgpPEALFKLFFWIGYCNSSVNPIIYTIFNrDFRK 395
gi 47213063  332 lsrskvaqMREKRFTFVLAVVMGVFVLCWFPFFFTYSLHavcrenctiPDSLFNLFFWIGYCNSCLNPIIYTVFNrDFRR 411
gi 68052354  323 lsksklaqMREKRFTFVLAVVMGVFVLCWFPFFFTYSLHaicrksctiPDSLFNLFFWIGYCNSSVNPIIYTIFNrDFRK 402
gi 21322670  328 mnktkvaqMREKRFTFVLAVVMGVFVLCWFPFFFTYTLHaicrdrcyiPGALFNLFFWIGYCNSSVNPIIYTIFNrDFRK 407
gi 512829486 301 isqmrltqLREKRLTFVLAVVIGGFVICWFPFFFTYSLEsvcrkrcgiSDALFNFFFWIGYCNSSLNPIIYTVFNrDFRK 380

                 ..
Feature 1          
gi 68052355  396 AF 397
gi 47213063  412 AF 413
gi 68052354  403 AF 404
gi 21322670  408 SF 409
gi 512829486 381 AF 382

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap