Conserved Protein Domain Family
7tmA_5-HT7

?
cd15329: 7tmA_5-HT7 
serotonin receptor subtype 7, member of the class A family of seven-transmembrane G protein-coupled receptors
The 5-HT7 receptor, one of 14 mammalian serotonin receptors, is a member of the class A of GPCRs and is activated by the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). 5-HT7 receptor mainly couples to Gs protein, which positively stimulates adenylate cyclase, leading to increased intracellular cAMP formation and calcium influx. 5-HT7 receptor is expressed in various human tissues, mainly in the brain, the lower gastrointestinal tract and in vital blood vessels including the coronary artery. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.
Statistics
?
PSSM-Id: 320452
View PSSM: cd15329
Aligned: 19 rows
Threshold Bit Score: 258.74
Threshold Setting Gi: 198433837
Created: 13-Nov-2008
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence similarity to Human 5-HT1B G protein-coupled receptor bound to the agonist antimigraine medications dihydroergotamine and ergotamine.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                     ## 
gi 2494929    71 IVIGVVLSIITLFTIAGNALVIISVCIVKKLrq-pSNYLVVSLAAADLSVAVAVMPFVIITDLvggeWLFGkvfCNVFIA 149
gi 2443304    38 VFLIIVLTIFLVGTAGGNLLVISSVAIVKKLqt-sSNFLIVNLACSDFLVSILVLPGAVHQVIyrgqWPFSeilCDIFIS 116
gi 170588433  35 AIICLLIGMIIVATLVGNSLVIMAVLLVRKLkiqpANYLFVSMAVADFCVGLFVMPIALIDLLtd-rWILGgvvCRFWTS 113
gi 198433837  25 ALIAALTSLLSLLIVVGNGLIIVSVALVKKLrq-pANYLIVSLALSDFLVGLVVLPLTIVYDImg-eWVFGpnvCDVHVS 102
gi 2443302    57 VFLGIIFFIIVVGAIGGNFLVILAIILVKKLqt-aSNWLILSLAFSDFFVSVLVMPIAAFNQLsrfrWPFSeklCDFYNC 135
gi 47222385   21 VLIGGVLTMLTLSTICGNLLVVISVCFVKKLrq-pSNYLIVSLAVADLSVALAVMPFVSITDLiggqWVFGqffCNVFIA 99
gi 8488960    82 VVIGSILTLITLLTIAGNCLVVISVCFVKKLrq-pSNYLIVSLALADLSVAVAVMPFVSVTDLiggkWIFGhffCNVFIA 160
gi 291062144  78 VVIGAVLSLITLLTVAGNCLVVISVCFVKKLrq-pSNYLIVSLALADLSVALAVMPFVSVTDLiggeWIFGrlfCNVFIA 156
gi 353229437  36 GIIFILSLIVAIATAGGNFLVILAVILVKKLqt-pSNILIGSLAFSDFFVALLVLPFTIIDAYqg-yWPFNeglCDMYIS 113
gi 260590530  20 LILGIVFCILILGTVIGNGLVILSVVLAKRLqt-pNNILIVNLAISDMLVALLVLPLATIYQLkg-yWMFNeivCDFFIV 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ##  ##                                                                         
gi 2494929   150 MDVMCCTASIMTLCVISVDRYLGITRPLTYPARQnGKLMAKMVFIVWLLSASITLPPLFgwakn---------------- 213
gi 2443304   117 FDVILCTSSILNLCAISIDRYLVITRPLQYAVNRtPARIGTMVAISWVTSALISIPPMFglket---------------- 180
gi 170588433 114 ADLTLCTASIVNLCMISVDRYCAVSQPLRYAAQRtRQRIFCYVIIVWILSLIVSISPLViwpak---------------- 177
gi 198433837 103 FDVICCTASIMNLCMISIDRYLMITQPMTYPKRRtGKLMLLLIATAWVLSCLVIIPALFgftknvkdeadwlplnndslv 182
gi 2443302   136 CDVMLCTSSILNLCAISIDRYLVITRPMQYVVRRtPALIGGMIGVAWLMSGLISIPPVLgwkek---------------- 199
gi 47222385  100 MDVMCCTASIMTLCVISIDRYLGITNPLTYPVRQnGCCMAKMILSVWLLSASITLPPLFgwaqn---------------- 163
gi 8488960   161 MDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQnGKCMAKMILSVWLLSASITLPPLFgwaqn---------------- 224
gi 291062144 157 MDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQnGKCMAKMILCVWLLSASITIPPLFgwaqn---------------- 220
gi 353229437 114 FDVLLCTASILNLCAISIDRYLVITKPLTYASRRtPQRMAAMIATAWIGSALISIPPNFgwkdp---------------- 177
gi 260590530  98 CDVLLCTASILNLCAISIDRYLVITKPFQYITKRnNKLMVTMVGISWLASALISIPPLFgwkqk---------------- 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2494929       --------------------------------------------------------------------------------
gi 2443304       --------------------------------------------------------------------------------
gi 170588433     --------------------------------------------------------------------------------
gi 198433837 183 gnetfalagarnpylaidgngttqwvpgnnelsewhftvdlgvihqldivsienakgskqhdlqyslltspcrestawts 262
gi 2443302       --------------------------------------------------------------------------------
gi 47222385      --------------------------------------------------------------------------------
gi 8488960       --------------------------------------------------------------------------------
gi 291062144     --------------------------------------------------------------------------------
gi 353229437     --------------------------------------------------------------------------------
gi 260590530     --------------------------------------------------------------------------------
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               #           #   #        
gi 2494929   214 -------------------------------------------------vnverVCLISqDFGYTVYSTAVAFYIPMTVM 244
gi 2443304   181 --------------------------------------------------fipgQCNYSdNLIYQIYATFGAFYIPLIVM 210
gi 170588433 178 --------------------------------------------------ntegKCQVIqNPVYQIYATIIAFYGPTCIM 207
gi 198433837 263 katfavesgpsrqetrlptevearylrfainqtagyenpmlgefqvfgikkygkACLISqERWFTIYSTLGAFYLPLAVM 342
gi 2443302   200 --------------------------------------------------ftpgICQLTdNLLYQIYATFCAFYIPLIVM 229
gi 47222385  164 -------------------------------------------------vndgrVCLISqDFGYTVYSTAVAFYIPMSVM 194
gi 8488960   225 -------------------------------------------------vnddkVCLISqDFGYTIYSTAVAFYIPMSVM 255
gi 291062144 221 -------------------------------------------------vndekVCLISqDFGYTIYSTAVAFYIPMSVM 251
gi 353229437 178 --------------------------------------------------fqkcACEYSkNVGYQVYATFFAFYLPLIVM 207
gi 260590530 162 --------------------------------------------------felgQCIYSdSLGYQIYATFGAFYIPSIIM 191
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2494929   245 LVMYQRIFVAAkisaekhkfvniprlyeqegiycledklpp--------------------------------------- 285
gi 2443304   211 LILYGRIFKLAremaqndaklkigispnssdkeqhshlrivdshicntpn------------------------------ 260
gi 170588433 208 VILYAKMWLAAkrlserdrllivgtnrsvngtilakphspaslnepssrsnnnnnennn--------------------- 266
gi 198433837 343 LCMYWKIYLEAsrfnarhrlrsysttgsqewsggsppstpdvtnnrrheqfyerkrtyssnnnytndkfhstksegyvtd 422
gi 2443302   230 LVLYYQIFKLArnmaqedakrklgtgqmtdeeqtsipiqlgrtnsgdedr------------------------------ 279
gi 47222385  195 LIMYYRIYRAAklsaakhtitgfprqgehgapaaprggeggravpqstvseetrrvegev-------------------- 254
gi 8488960   256 LFMYYQIYKAArksaakhkfpgfprvepdsvialngiv------------------------------------------ 293
gi 291062144 252 LFMYYQIYKAAkrsaakhkfagfprpeemegismngvi------------------------------------------ 289
gi 353229437 208 IILYGRIFKLAremsrsgqskmtagishdehivtkainngvkkdedtndic----------------------------- 258
gi 260590530 192 IVLYGRIYQIAkhsaamdshlksirgsickdpmtihscnssykssqsdiqsqtsfsghissarhninsniyrsctttdl- 270
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2494929       --------------------------------------------------------------------------------
gi 2443304       --------------------------------------------------------------------------------
gi 170588433     --------------------------------------------------------------------------------
gi 198433837 423 ssevllantavtpivvtdldldkakdsvfeddtvsssgdeflpsdrlekvepktngngvvlnghviakiaiendrktnsl 502
gi 2443302       --------------------------------------------------------------------------------
gi 47222385      --------------------------------------------------------------------------------
gi 8488960       --------------------------------------------------------------------------------
gi 291062144     --------------------------------------------------------------------------------
gi 353229437     --------------------------------------------------------------------------------
gi 260590530     --------------------------------------------------------------------------------
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2494929       --------------------------------------------------------------------------------
gi 2443304       --------------------------------------------------------------------------------
gi 170588433     --------------------------------------------------------------------------------
gi 198433837 503 pcrglvhrngsavslpckdstngnavnlirsssgvvcglgmkngfprngttrhngmewrfptisevdiltslneegeqtn 582
gi 2443302       --------------------------------------------------------------------------------
gi 47222385      --------------------------------------------------------------------------------
gi 8488960       --------------------------------------------------------------------------------
gi 291062144     --------------------------------------------------------------------------------
gi 353229437     --------------------------------------------------------------------------------
gi 260590530     --------------------------------------------------------------------------------
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2494929       --------------------------------------------------------------------------------
gi 2443304   261 -------------------------------------------------------------------------------g 261
gi 170588433 267 -----------------------------------------------------------------------nstdnnnnn 275
gi 198433837 583 ketetetingkineeyrartlytrasansllatektpklvgkpsprsrlfmlygkprllratstpcptttnkpntqhtrk 662
gi 2443302       --------------------------------------------------------------------------------
gi 47222385  255 ---------------------------------------------------------------------eveeesldcva 265
gi 8488960       --------------------------------------------------------------------------------
gi 291062144     --------------------------------------------------------------------------------
gi 353229437 259 -------------------------------------------------------------------------------k 259
gi 260590530 271 --------------------------------------------------rhscqltlpdkrlvrnsfpgitdcqnksnr 300
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                  #  ##     #           
gi 2494929   286 --------kknskkkkaveefaslsklirqdrknisifKREQKAARTLGIIVGAFTFCWLPFFLLSTARPFIcgim---- 353
gi 2443304   262 qmnlslysgslcsisksnnlsdsspnkvnlrnrvklksSTETKAITTLGVIMGCFTICWLPFFLIQISKPVLkvanvd-- 339
gi 170588433 276 nsrlhhhhhyhyrqqyhhhrppailqkipmvhinkfheKSEGKARKTLGIMMSVFVICWLPFFLLALLKSQGfl------ 349
gi 198433837 663 ssfrtlrqnseitfpcnrrptvfnqirrrvslatsrdrMRNVKATRTLGIVVGAFTFCWLPFFIVTFLRPFAcpipe--- 739
gi 2443302   280 kllrledaqrlskgnqgngfdpeaqtgpknnakkkkqvNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILivskvd-- 357
gi 47222385  266 aalklqreveeecstrvsrllktgeyhqrrqrknqsifKREQKAAATLGIVVGAFTFCWLPFFLVSTARPFVcgve---- 341
gi 8488960   294 ------------klqkeveecanlsrllkherknisifKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFIcgts---- 357
gi 291062144 290 ------------klhkeseectnfsrllkndkknisifKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFIcgta---- 353
gi 353229437 260 areydkrlnsyssrklltdsmnvtselsreahgrrsrgNSDTKVIKTLGVIMGCFCLCWLPFFMIQLLLALLsaagyn-- 337
gi 260590530 301 nsrsnskhsttirvllsasrdtltkrwkeiihsskrssQSEGKAIFTLGVIMGCFCICWMPFFIIQILTPIFkiihghnp 380
                        730       740       750       760
                 ....*....|....*....|....*....|....*....|.
Feature 1                #  ##  #   #                     
gi 2494929   354 ---cscmPLRLERTLLWLGYTNSLINPLIYAFFNRDLRTTF 391
gi 2443304   340 --smnyfPIWLIELCLWLGYFNSFLNPIIYAKFNREFRTPF 378
gi 170588433 350 ------pPNWLDHLALWLGYSNSLMNPLIYCKHNREFRIPI 384
gi 198433837 740 --sqdciPLWLVRFVLWLGYLNSALNPLIYIGFSPDLRETF 778
gi 2443302   358 --hekylMPWCYELFLWLGYFNSFLNPVIYAKFNREFRNPF 396
gi 47222385  342 ---cscvPLWLERTLLWLGYANSLINPFIYAFFNRDLRTTY 379
gi 8488960   358 ---csciPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTY 395
gi 291062144 354 ---csciPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTY 391
gi 353229437 338 --tvnmiPVSVFRFLQWLGYVNSFLNPLIYAKFDREFRGPF 376
gi 260590530 381 saklftiPQSVSELFLWLGYFNSFLNPIIYVKFNKEFRTPF 421

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap