3V2Y


Conserved Protein Domain Family
7tmA_S1PR1_Edg1

?
cd15346: 7tmA_S1PR1_Edg1 
Click on image for an interactive view with Cn3D
sphingosine-1-phosphate receptor subtype 1 (S1PR1 or S1P1), also called endothelial differentiation gene 1 (Edg1), member of the class A family of seven-transmembrane G protein-coupled receptors
The endothelial differentiation gene (Edg) family of G-protein coupled receptors binds blood borne lysophospholipids including sphingosine-1-phosphate (S1P) and lysophosphatidic acid (LPA), which are involved in the regulation of cell proliferation, survival, migration, invasion, endothelial cell shape change and cytoskeletal remodeling. The Edg receptors are classified into two subfamilies: the lysophosphatidic acid subfamily that includes LPA1 (Edg2), LPA2 (Edg4), and LPA3 (Edg7); and the S1P subfamily that includes S1P1 (Edg1), S1P2 (Edg5), S1P3 (Edg3), S1P4 (Edg6), and S1P5 (Edg8). The Edg receptors couple and activate at least three different G protein subtypes including G(i/o), G(q/11), and G(12/13).
Statistics
?
PSSM-Id: 320468
View PSSM: cd15346
Aligned: 5 rows
Threshold Bit Score: 461.268
Threshold Setting Gi: 375332588
Created: 25-Dec-2013
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:3V2Y: Human lipid-sensing GPCR, the S1P1 receptor fused to T4-lysozyme, in complex with the selective antagonist sphingolipid mimic (R)-3-amino-(3-hexylphenylamino)-4-oxobutylphosphonic acid (ML056), contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               #   #              ##  ##
3V2Y_A        64 KLTSVVFILICCFIILENIFVLLTIWKTKKfhrPMYYFIGNLALSDLLAGVAYTANLLLSgATTYKLTpaqWFLREGSMF 143
gi 59797887   25 KADSVVFIIVCCFIILENVLVLLTIWRTKKfhkPMYYFIGNLALSDLLAGVVYTANILLSgANTYKLTptqWFFREGSMF 104
gi 148231129  38 KPTSIIFIIICCFIVLENILVLLTIWRTKKfhrPMYYFIGNLALSDLLAGTAYTANILLSgPHTYKLTpveWLIREGSMF 117
gi 205371820  46 KLTSVVFILICCFIILENIFVLLTIWKTKKfhrPMYYFIGNLALSDLLAGVAYTANLLLSgATTYKLTpaqWFLREGSMF 125
gi 465972935  44 KVTSVVFIIICCFIILENIFVLLTIWKTKKfhrPMYYFIGNLALSDLLAGVAYTANLLLSgHKTYSLTptqWFVREGSMF 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          #                                                                 #           
3V2Y_A       144 VALSASVFSLLAIAIERYITMLKMkLHNGSNNFRLFLLISACWVISLILGGLPiMGWNCIsalssCSTVLPLYHKHYILF 223
gi 59797887  105 VALAASVFSLLAIAIERHLTMLKMkLHNNGKTCRVFMLISTVWFIAAILGGLPvMGWNCIdsmnnCSTVLPLYHKAYILF 184
gi 148231129 118 VALSASVFSLVAIAIERYITMLKMkLHNGSKSSRSFLLISGCWFLALILGGLPiMGWNCIsqmsaCSTVLPLYHKHYILF 197
gi 205371820 126 VALSASVFSLLAIAIERYITMLKMkLHNGSNNFRLFLLISACWVISLILGGLPiMGWNCIsalssCSTVLPLYHKHYILF 205
gi 465972935 124 VALSASVFSLLAIAIERYITMLKMkLHNGSNSFRSFLLISACWVISMILGGLPiMGWNCLdhlqsCSTVLPLYHKHYILF 203
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #                                                                               
3V2Y_A       224 CTTVFTLLLLSIVILYCRIYSLVRTRnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntn 303
gi 59797887  185 CTTVFSVILMAIVILYARIYALVRTRsrklvfrkv--------------------------------------------- 219
gi 148231129 198 CTTIFCALLMAIVILYARIYFLVRTRsrsltfkr---------------------------------------------- 231
gi 205371820 206 CTTVFTLLLLSIVILYCRIYSLVRTRsrrltfrk---------------------------------------------- 239
gi 465972935 204 CTTVFTGLLLSIVVLYCRIYSMVRTRsrrltfrk---------------------------------------------- 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3V2Y_A       304 gvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrmlqqkrwdeaavnlak 383
gi 59797887      --------------------------------------------------------------------------------
gi 148231129     --------------------------------------------------------------------------------
gi 205371820     --------------------------------------------------------------------------------
gi 465972935     --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                          #      #                 #  # 
3V2Y_A       384 srwynqtpnrakrvittfrtgtwdayasrSSENVALLKTVIIVLSVFIACWAPLFILLLLDVGCkvktCDILFRAEYFLV 463
gi 59797887  220 --------------------angrgsnksSEKSMALLKTVIIVLSCFIACWAPLFILLLLDVACqtltCSILYKAEWFLA 279
gi 148231129 232 ---------------------nlarpsrsSEKSMALLKTVIIVLSVFILCWSPLFIFLLLDFGCkvkaCPVLFKAEYFLS 290
gi 205371820 240 ---------------------niskasrsSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCkvktCDILFRAEYFLV 298
gi 465972935 238 ---------------------nitkatrsSEKSLALLKTVIIVLSAFIACWSPLFILLLLDVGCkvkaCSILFKAEYFLV 296
                        410       420
                 ....*....|....*....|....
Feature 1                                
3V2Y_A       464 LAVLNSGTNPIIYTLTNkeMRRAF 487
gi 59797887  280 LAVLNSAMNPLIYTLTSneMRRAF 303
gi 148231129 291 LAVLNSATNPIIYTLTNreMRRAF 314
gi 205371820 299 LAVLNSGTNPIIYTLTNkeMRRAF 322
gi 465972935 297 LAVLNSATNPIIYTLTNkeMRRAF 320

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap