Conserved Protein Domain Family
7tmA_LGR5

?
cd15363: 7tmA_LGR5 
leucine-rich repeats-containing G protein-coupled receptor 5, member of the class A family of seven-transmembrane G protein-coupled receptors
The leucine-rich repeat containing G-protein coupled receptor LGR6, together with its family members LGR4 and LGR5, is structurally related to the glycoprotein hormone receptor family, which includes the luteinizing hormone (LH) receptor, the follicle-stimulating hormone (FSH) receptor, and the pituitary thyroid-stimulating hormone (TSH) receptor. LGR4-6 are receptors for the R-spondin (Rspo) family of secreted proteins containing two N-terminal furin-like repeats and a thrombospondin domain. The Rspo proteins are involved in regulating proliferation and differentiation of adult stem cells by potently enhancing the WNT-stimulated beta-catenin signaling. LGR6 serves as a marker of multipotent stem cells in the hair follicle that generate all skin cell lineages, whereas LGR5 is a marker for resident stem cell in numerous epithelial cell layers, including small intestine, colon, stomach, and kidney. In addition, LGR4 is broadly expressed in proliferating cells, and its deficient mice display development defects in multiple organs. Members of this group are characterized by a very large extracellular N-terminal domain containing 17 leucine-rich repeats (LRRs), flanked by cysteine-rich N- and C-terminal capping domains, and the extracellular domain is responsible for high-affinity binding with the Rspo proteins.
Statistics
?
PSSM-Id: 320485
View PSSM: cd15363
Aligned: 5 rows
Threshold Bit Score: 499.757
Threshold Setting Gi: 519882957
Created: 15-Dec-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative peptide ligand binding pocket [polypeptide binding site]
Evidence:
  • Comment:based on the structures of some class A family members with bound ligands (peptides or chemicals), agonists, or antagonists
  • Comment:Small-molecule chemical ligands tend to bind deeper within the receptor core, compared to a peptide ligand neurotensin, which binds towards the extracelllular surface of its receptor.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               #  ##                   #
gi 21542118  558 WLIRIGVWTIAVLALTCNALVTSTVFRSPLYispIKLLIGVIAAVNMLTGVSSAVLAGVDAftfgsfarhGAWWENGvGC 637
gi 254763312 558 WLIRIGVWTTAVLALSCNALVALTVFRTPLYissIKLLIGVIAVVDILMGVSSAVLAAVDAftfgrfaqhGAWWEDGiGC 637
gi 118082422 559 WLIRIGVWTIVGLTFVCNALVTATVFRSPLYmssIKLLIGLIGIVNALMGLSSGVLASVDAstfgsfaqyGAQWESGiGC 638
gi 519882957 558 WLIRIGVWTIAVLALTCNALVTSTVFRAAVYissIKLLIGLIAAVNMLMGVSSAVLAGVDAftfgsfaqhGAWWEQAvGC 637
gi 519882068 554 WLTRIGVWLIVLLSFVCNALVIATVFRPLSYvpsIKLLIGLIAIINTLMGLSSGVLATVDAltfgnfaqyGAWWESGvGC 633
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ##### ##  #                                            # #####                  
gi 21542118  638 HVIGFLSIFASESSVFLLTLAALERGFSVKYSAkFETKApFSSLKVIILLCALLALTMAAVPLLGGskygaSPLCLPlpf 717
gi 254763312 638 QIVGFLSIFASESSIFLLTLAALERGFSVKCSSkFEVKApLFSLRAIVLLCVLLALTIATIPLLGGskynaSPLCLPlpf 717
gi 118082422 639 QMTGLLSIFASEASIFLLTLAALERAFSIKHATkFETKSsIASVKIAIFFCFILALVIAVIPLLTGseygvSPLCLPlpf 718
gi 519882957 638 QVVGFLSIFASESSVFLLTLAALERGWSVKCSAkFETQTpFPSLRATLALCALLAGTVAAVPLLGGseysaSPLCLPlpf 717
gi 519882068 634 QITGFLSVFAAETSVFLLTVAALERGFSIKCTTkFETKSsFLSVKLSIVFCFLLSIIIAVSPLMSGstygtSPFCFPllf 713
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #  ### ### ##                                             #  ## ##  #        
gi 21542118  718 gePSTMGYMVALILLNSLCFLMMTIAYTKLYCNldKGDLENIWDCSMVKHIALLLFTNCILNCPVAFLSFSSLINltfis 797
gi 254763312 718 gePSTTGYMVALVLLNSLCFLIMTIAYTKLYCSleKGELENLWDCSMVKHIALLLFANCILYCPVAFLSFSSLLNltfis 797
gi 118082422 719 gePTAMGYMVALVLLNSLCFLVMTIAYTKLYCSleKGELDNIWDCSMVKHIALLLFTNCILYCPVAFLSFSSLLNltfis 798
gi 519882957 718 gePRATGYMVALVLLNSLCFLVMTVAYTRLYCHleKGDLESMWDCSMVKHVALLLFTNCILHCPVAFLSFSSLLNltfis 797
gi 519882068 714 gdPSSMVFMVALVLLNSLCFLVMTVAYTKLYCSleKGELENVWDCSMVKHIALLLFTNCILYCPVAFLSFSSLLNltfis 793
                        250       260       270
                 ....*....|....*....|....*....|....
Feature 1        ## ###  #  ##                     
gi 21542118  798 PEVIKFILLVVVPLPACLNPLLYILFNPHFKEDL 831
gi 254763312 798 PDVIKFILLVIVPLPSCLNPLLYIVFNPHFKEDM 831
gi 118082422 799 PEVIKSILLVIVPLPACLNPLLYILFNPHFKEDL 832
gi 519882957 798 PEVIKFILLVIVPLPACLNPLLYILFNPHFKEDL 831
gi 519882068 794 PEVNKSILLLIIPLPACLNPLLYILFNPHFKEDI 827

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap