Conserved Protein Domain Family
7tmA_OR5B-like

?
cd15407: 7tmA_OR5B-like 
olfactory receptor subfamily 5B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5B and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320529
View PSSM: cd15407
Aligned: 13 rows
Threshold Bit Score: 395.635
Threshold Setting Gi: 528978926
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                #  ##           ###### #
gi 38372840   23 IPLFILFTFIYLLTLCGNLGMMLLILMDSCLHTPMYFFLSNLSLVDFGYSSAVTPKVMAGFLrGDKVISYNACAVQMFFF 102
gi 47577195   24 VPLFIIFTLIYLTTLVGNLGMILLIILDSRLHTPMYFFLSNLSFADCVYASAVTPKVIEGFLtEDKIISYNACAAQMFFF 103
gi 47577171   23 VPLFITFSLIYLITLIGNLGMIVLIWLDSRLHTPMYIFLSHLSLADCVYSSSVTPKVMAGFLtGDKVISYGGCVAQMFFF 102
gi 160417538  23 IPLLLAFLFIYLITLLGNGGMMVIIHSDSHLHTPMYFFLSNLSLVDLGYSSAVAPKTVAALRsGDKAISYDGCAAQFFFF 102
gi 47577155   23 TPLFIIFTLIYFINMTGNLGMLVLILWDSRLHTPMYIFLGNLSLVDIFYSSAVTPTVVAGLLvGNQAISYSACAAQMFLF 102
gi 38372681   23 VPLFIMFTLIYLITLTGNLGMIILILLDSHLHTPMYFFLSNLSLAGIGYSSAVTPKVLTGLLiEDKAISYSACAAQMFFC 102
gi 507950280  23 IPLFFIFMLIYLITLIGNMGMIVLILVDSRLHTPMYFFLSNLSLADLGYSTAVTPKVMAQLLtGSNVISYNACAAQLFFF 102
gi 548497240  23 IPLFLVFTLIYLLTLVGNLGVITLILLDSRLHTPMYVLLSHLSLVDFAYSTAVTPKVMAGFLvGDKAISYNACATQLFFF 102
gi 507699801  23 IPLFITFLIIYFLTLVCNLGMILLILLDSRLHTPMYLFLSNLSLADIGYSSAVTPRVMTGLLtGDNVISFYDCAIQLFSF 102
gi 528978926  62 VVLFIMFAILYLTHEVGNLGMITLLLLDSCLHNPTHXFFSNLFLENSGYSSAVXPVVMAGLLtGDKIISYNARAAQIFFF 141
gi 395545308  26 VLLFVIFTLIYIFTLVGNLGLVTLIWVESTLHMPMYFFLSSLSLVDLGSSSAIIPKVLAGILtGDKTISYNDCATQMFFF 105
gi 617587538  26 MPLFLIFTLIYFFTLVGNLGLILLILLDSRLHTPMYFFLSNLLLVDCVYSSAVTPKVLVGLLpGDKVIPSNACAAQMFFF 105
gi 507699793  23 IPFLVTFLVIYLITLVGNLGMMLLLFLDSHLHTPMYFFLSNLSLADFGYSSAVTPKLIVVLLtGDNIISYNDCATQFFFF 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 38372840  103 VALATVENYLLASMAYDRYAAVCKPLHYTTTMTASVGACLALGSYVCGFLNASFHIGgIFSLSFCKSnlVHHFfCDVPAV 182
gi 47577195  104 GVFAIIESFLLASMAYDCHAAVCKPLHYSTTMTTMICSLLLAGSYVSGILQSSIHVAfTFHLSFCHSnvVNHFfCDIPPL 183
gi 47577171  103 VAFASVDCFLLAVMAFDRHAAVCKPLHYTTTMTTSVCARMVIACYAWGLFESAIHTGfTFSLPCCANv-VHHFfCDIPPI 181
gi 160417538 103 VGFATVECYLLASMAYDRHAAVCRPLHYTTTMTAGVCALLATGSYVSGFLNASIHAAgTFRLSFCGSneINHFfCDIPPL 182
gi 47577155  103 VVFATAENFLLAAMAYDRYAAVCKPLHYTTTMTPTTCACLTIACYAGGFLNSSIHTGdTFRLYFCKSnvVHHFfCDVPAV 182
gi 38372681  103 AVFATVENYLLSSMAYDRYAAVCNPLHYTTTMTTRVCACLAIGCYVIGFLNASIQIGdTFRLSFCMSnvIHHFfCDKPAV 182
gi 507950280 103 AVFLTVETFLLAVMAFDRYAAVCKPLHYATIMTTGVCECLIIGCYAFGFMDASVHIWnIFSLSYCRSnvINHFfCDGPPV 182
gi 548497240 103 AVFLAVETFLLASMAYDCHAAACKPIHCSNIMTARVCAWTVVASYGLGFLVASVHTWnAFSLSFCRSrvIGHFsCGATPV 182
gi 507699801 103 GVFAIIESDLLVVMAYDRYVAVCRPLHYNTLVTTKVCAFLCLGCYVLALLDECIHTWnIFRLSFCKSnvIDHFfCDVPPV 182
gi 528978926 142 VAFASVEPCLLASVVYDCHTAVHKPLHNTTTTTTHVCAPLTMGSYVCSFLNASFHVGdIFGPSLCKSn-IAHHxCEVPAV 220
gi 395545308 106 VTFATTENYLLAAMAYDRHVAVSKPLHYSTIMSSKMCLGLTICCYICGSVNSSIHIGfTFSLSFCSSniVNHFfCDIPPI 185
gi 617587538 106 AAFVITECFLLTLMSFDCYIAMCKPLHYTTTMTSTVCAFLIARCYICGLLQSSLDVVfTFCLSFCHSnvVNHFfCDIPPL 185
gi 507699793 103 VTFITVETFLLASMAYDRFIAVCKPLHYTTIMTRKVCAYLVMGPYVCGFLDACIHTWnIFRLSFCRSnvIDHFfCDAPPL 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #  ### ### ##                                              #  ## ##  #
gi 38372840  183 MALSCSDkhtSEVILVFMSSFNIFFVLLVIFISYLFIFITILKMh--sAKGHQKALSTCASHFTAVSVFYGTVIFIYLQP 260
gi 47577195  184 LSLSCSSiytNEIVLFMLAAFDVGFTLLVILTSYLLIFVAILRMn--sAESRKKAISTCSSHLTTVSIFYGTIIFMYLQP 261
gi 47577171  182 LALSCSDiyvNEIVLFILASFNVFFALIVILTSYAFIFIAILRMr--sAEGQKKAFSTCASHLTAVTIFYGTVIFMYLQP 259
gi 160417538 183 LALSCSDt-rISKLVVFVAGFNVFFTLLVILISYFFICITIQRMh--sAEGQKKVFSTCASHLTALSIFYGTIIFMYLQP 259
gi 47577155  183 MVLSCSDrhvSEMILLYGASFVICSALLVILISYIFIFITIFKMr--sTAGYQKAMSTCVSHFTAVSIFYGTLIFMYLQP 260
gi 38372681  183 ITLTCSEkhiSELILVLISSFNVFFALLVTLISYLFILITILKRh--tGKGYQKPLSTCGSHLIAIFLFYITVIIMYIRP 260
gi 507950280 183 LALSCSDihrSEWVLFIFVGINVLISNVVIVVSYLFIFVTVLRMh--sSEGHRKAFSTCASHLTAISIFYGTGIFMYLES 260
gi 548497240 183 LALSCSDssrSEMVVFVLVSFNIAFTLLIILISYLFIFVTILRVr--sSEGHRKAFSTCASHLTSISIFYGTGAFMYQQP 260
gi 507699801 183 LAISCSDihsSEIIMFFIVACNAFFSLTVILSSYVLIFATILRMr--sAEGRKKAFSTCAAHLTVVTGLYGTITFAYLKP 260
gi 528978926 221 LALSSSHkhiSEVVLVFIMNFNVSFALLIILISLSIQFSSVQSLshalSSGHQKALSTCASHLTAVSIFYGTVIFMDLQP 300
gi 395545308 186 LTLSCSNirfTELLVCILGAFNMAFAILVIVVSYLSIFIAILRIr--sTEGRQKAFFTCASHIFAVSLFYGATIFMYLQP 263
gi 617587538 186 LELSCSDistNEIVTFKMAAFNLSCFLLVIFSSYLLISVAILRMq--sAEGWRKAFSTCASHLTTVCIFYGTIIFMYLQP 263
gi 507699793 183 LTISCSDryiTELVIFCVVSFNVLSSIAVILISYLFILTTILRMr--sSEGRHKAFSTCASHLTTVSIFYGTASFMYLQP 260
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
Feature 1             ## ###  #  ##                       
gi 38372840  261 sSSHSMDTDKMASVFYAMIIPMLNPVVYSLRNREVQNAFKK 301
gi 47577195  262 sSSHSMDTDKMASVFYTMVIPMLNPIVYSLRNKEVKNAFKK 302
gi 47577171  260 sSSHSMDNDQMASVFYTMVVPMLNPVVYSLRNKEVHNAFKK 300
gi 160417538 260 nSSQSVDTDKIASVFYTVVIPMLNPLIYSLRNKEVKSALWK 300
gi 47577155  261 sSHHSMDTDKIVSVFYTMVIPMLNPVVYSLRNKEVKSAFKK 301
gi 38372681  261 sSSHSMDTDKIASVFYTMIIPMLSPIVYTLRNKDVKNAFMK 301
gi 507950280 261 nASHSMGSDKLASMFYAIVIPMLNPLVYSLRNKEVKSAFKR 301
gi 548497240 261 gSRHSMSTDKMASVFYALVVPMVNPLICSLRNKEVKRALKK 301
gi 507699801 261 sSGHSMDLDKLASLFYSIVLPMLNPLVYSVRNKEVKSAFIK 301
gi 528978926 301 sSRHSTDPHKVASVFYSVLIPMLTSVGYSLGNMEVKEQAHN 341
gi 395545308 264 sSNHSMESDKMISVFYTMIIPMLNPLVYSLRNKDVKNAFIK 304
gi 617587538 264 nSNHSMDTDKMASVFYTIIIPTLNPLVYSLRNKEFKSAFSK 304
gi 507699793 261 rYSHSMGTDKMASLFYAIFVPMLNPLIYSLRNKEVKAAFQR 301

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap