Conserved Protein Domain Family
7tmA_OR5AK3-like

?
cd15408: 7tmA_OR5AK3-like 
olfactory receptor subfamily 5AK3, 5AU1, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5AK3, 5AU1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320530
View PSSM: cd15408
Aligned: 16 rows
Threshold Bit Score: 461.02
Threshold Setting Gi: 449283441
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                             #  ##      
gi 38372828   12 FHLLGFGVQHEFQHVLFIVLLLIYVTSLIGNIGMILLIKTDSRLQTPMYFFPQHLAFVDICYTSAITPKMLQSFTEENNL 91
gi 663292430  12 FTFLGLTEHPQQKLLLFVLFLGIYVLTVLGNLGLITLIRLSPQLHTPMYFFLGCLSFLDICYSSTITPKMLLDLPTTNKV 91
gi 557323594  12 FILSGFTDLPALQVPLFMLFLGVYSITVVWNLGMYLLIRVDFRLHTPMYFFLSHLSFVDVCYSSAITPRLLSDLLAEKKV 91
gi 449283441   9 VTEFVLLGFTNLQELLFVVFLIIYLTTLVGNLGMIVLIRTNSQLHVPMYFFLGHLSLLDICYSSSVTPKLLLGLLAERNV 88
gi 557318226  27 VTEFILLGFMELKVPLFLLFLIIYIITLVGNLGMIVLITNAPRLHTPMYFFLSNLSFIDICYSSSVTPKLLLGLLVERNS 106
gi 602664847  10 FILTGLTDDPQVQLILFGTFLAVYAITLVGNVGMIVLIRINPQLHTPMYFFITNLSFLDICYSSSVTPKLLSNLLKENKV 89
gi 564248036  12 FSLSGFTVHLELQVHLLGVFLSIYVITVVGNLGMILLIRSDSRLHTPMYFFLSNLSFVDFSLSSCITPKLLRNLLADRKV 91
gi 71895899   31 FVLLGFSEKRAIQAVLFMGFLLIYLITLLGNVGMITLIRLDSRLHTPMYFFLSSLSFLDICYSSTITPRVLSDLPASQKV 110
gi 47577371   12 FILLGFAGQHESWHILFVVFLIIYIATLVGNIGMILLIKLHSSLHTPMYFFLQHLAFVDLCYSSAITPKTLQNFVSSKPS 91
gi 527242241  12 FVFKGFTDCLDFQVTLFVLFLLIYVTTVIGNLGIIAAVWLDSQLQTPMYFFLGHLSFLDLCYSSVVTPKMLLSLLSERKT 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             ###### ##  #                                            # #####            
gi 38372828   92 ITFRGCVIQFLVYATFATSDCYLLAIMAMDCYVAICKPLRYPMIMSQTVYIQLVAGSYIIGSINASVHTGFTFSLSFCKS 171
gi 663292430  92 ISFPGCLTQLYFFAVFGTAEVYLLAAMAYDRYVAISKPLLYKAAMSPGLCWSLVAGSYLAGLLNASVHTSALLRLSFCGP 171
gi 557323594  92 ISYGGCLAQFYFFVLFGTTEGFLLAAMAYDRYMAICNPLLYMASMNSRVCLQLVVGCYLAGIINTTVHTGTMLRLSFCAS 171
gi 449283441  89 ISFNCCIAQFFFFAAFGTTEAILLAVMAYDRYVAVCQPLHYLASMSHRVCVQLVVGSYAAGSLNALVHTSALLRLSFCGP 168
gi 557318226 107 ISFIGCITQFYFYAVFGTTEALLLAAMAYDRYMAICNPLLYATAMPHRVCLKLVGSSYVAGTLNALVHTGTMLHLSFCGP 186
gi 602664847  90 ISFVGCFTQLYFYGLFGTTECYLLAVMAYDRYVAICNPLLYLITMSPKKRVQLIAFSYIAGIINALVHTTAASQLSYCGT 169
gi 564248036  92 ISYAGCLSQFYFYVVFGTTEGFLLAVMAYDRYMAICNPLHYRIAMSRRVCVSLIAGCYLGGIINSTVHTGTMLRLSFCEI 171
gi 71895899  111 ISHSACLAQFYFYAVFATTECYLLAAMAYDRYVAICSPLLYVFSMSSRVCVLLVAGSYLVGVVNATIHTGLALQLSFCGP 190
gi 47577371   92 ISFTGCIVQLLVYGIFVTSDCFILAAMAVDRYVAICNPLRYPIIMSQRLCILLLLGSYTMGFLNATVNTGFTFLSNFCKS 171
gi 527242241  92 ISFAGCFLQLYFYTAFVITECYLLAGMAYDRYVAICNPLRYLILMSQKVCVSLLAGSYAVGLFNSAIFTGFALRLSFCGP 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                               #  ### ### ##                                            
gi 38372828  172 NKINHFFCDGLPILALSCSNIdINIILDVVFVGFDLMFTELVIIFSYIYIMVTILKmsSTAGRKKSFSTCASHLTAVTIF 251
gi 663292430 172 LVINHFYCDVTPLLAVTSTDPrLNKGLVFVFVGFNLLATNLFILTSYTCLVVAVGRmgSAAGRHKAFSTCTSHLAAVVIF 251
gi 557323594 172 NVIKHFYCEGPPLYTISCTDTtINETVIFAFVSFVIVVTVSTIVTSYTYILATILRihSAEGRYKAFSTCTSHLMAVTLF 251
gi 449283441 169 NLINHFYCEMPPLLLLSCSDTrLNTMVLAVCVGFIVTTSVLAIVVSYTCILLTTRGvrSAEDRHKAFSTCTSHLTAVALF 248
gi 557318226 187 NIINHFYCEIPPLLSLSCTDTwPNEIVMYLFVGFTVIISTLAILISYAYILITILRirSAEGKIKAFSTCASHMMVVSLF 266
gi 602664847 170 NIIKHFYCEVPPILALACSNIsLNDLLMFLFVGFSVITTSLIILTSYTYILVTILKdhSAKSHQKALSTCTSHLMVIGIF 249
gi 564248036 172 SVINHFYCEAPPLYAISCTDTnINSMVIFAFTGIIILVTVTSIIVSYTFILAAILKirSAKGRHKAFSTCASHMTAVSLF 251
gi 71895899  191 NIINHFYCDGPPLYAISCTDPtTNEIAIFLVVGFNMLITSVTIFISYTYILFAVLRmhTAAGKRKTFSTCASHLATVTLF 270
gi 47577371  172 NTINHFFCDVPPILALSCSSIdLNIMVLTIFVGFNLTFTVSVVILSYTFILAAILRmsSAAGRRKAFSTCASHMTAVTIF 251
gi 527242241 172 NVIDHFFCDGPPLSKLACSDTsLNQMLLFAFGGFNKVTTISIILISYGHILFTVLR--TGSVLGKAFGTCASHLMVVTIF 249
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
Feature 1        #  ## ##  #     ## ###  #  ##                  
gi 38372828  252 YGTLSYMYLQPQSNNSQENMKVASIFYGTVIPMLNPLIYSLRNKEGK 298
gi 663292430 252 YVSAAFNYLQPTSPNSLEGKKIASIFYTILIPMLNPMIYSLRNKEVK 298
gi 557323594 252 YGSIAFMYLQPSSRHSQDLDKVASVFYTVVIPLLNPVIYSLRNKEVK 298
gi 449283441 249 YGSVAFLYLHPFSKRTEDQGKTASIFYTVVTPMLNPIIYSLRNREVR 295
gi 557318226 267 YGSVAFMYLRPSSRYSQGLDKIASVFYTVVSPMLNPLIYSVRNKEVK 313
gi 602664847 250 YGCCSFIYARPSSRQSHRLDQVASVFYVVVTPMLNPLIYSLRNQEVR 296
gi 564248036 252 YGSVAFMYLRPSSKHSQDVDKVASLFYTVVTPMLNPLIYSLRNKEVK 298
gi 71895899  271 YASAGSMYSRPSSRHSQDLDKVASVFYTMVTPMLNPLIYSLRNQEVK 317
gi 47577371  252 YGTLSYMYVLHGTNKSQEQEKVASVFYGIMIPMLNPLIYSLRNQDVI 298
gi 527242241 250 YGTLIFMYLRPSSSYSLGRDKIVSVFYTMVTPMLNPFIYSLRNKEVK 296

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap