Conserved Protein Domain Family
7tmA_OR5H-like

?
cd15409: 7tmA_OR5H-like 
olfactory receptor subfamily 5H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5H, 5K, 5AC, 5T and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320531
View PSSM: cd15409
Aligned: 9 rows
Threshold Bit Score: 453.403
Threshold Setting Gi: 218512125
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                #  ##           ###### #
gi 212276497  30 MPLFLVFLVIYLITIVWNLGLIALIWNDPQLHIPMYFFLGSLAFVDAWISSTVTPKMLVNFLAKNRMISLsECMIQFFSF 109
gi 334346752  25 VLFFLVFLGIYIITMVGNIGLIVLIWMDSHLHTPMYLFLGNLALADACTSTTVSPKMLVGFITQNQMISVpECMAQLYFF 104
gi 317373404  25 TLLFVVFFAIYLITVVGNISLVALIFTHRRLHTPMYIFLGNLALVDSCCACAITPKMLENFFSENKRISLyECAVQFYFL 104
gi 557267166  25 PILFVVLSMIYCITLVGNLSMVVLIWIDSRLHSPMYFFLGNLSLMDTCCSSSIIPKMLLNFVAGKKGISFsGCITQLFCF 104
gi 166215762  25 APLFLVFLVIYLITLVGNLGLMALIWKDPHLHTPIYLFLGSLAFADACTSSSVTSKMLINFLSKNHMLSMaKCATQFYFF 104
gi 47576333   25 VPLFLVFFLIYVTTMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACTSSSVTPKMLMKFLNKNDMISVgECFAQFYFF 104
gi 564246093  25 VPLFMLLQAMYIITVIGNLSIFFLITVDSHLHTPMYFFLASLSFLDICYSPVIFPKMLQNILSENKAISYnGCAAQMFFF 104
gi 47577603   23 IILFFLFLMIYLFTLMGNIGLIAVVIGNPQLHNPMYYFLGVLSFIDTCFSTIITPKMLIDFMSKKKVISFlGCTAQMFLA 102
gi 218512125  55 VFLFLLFFAIYLFTLIGNLGLVVLVIEDSWLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLAKNKSISFiGCATQMLLF 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 212276497 110 AFGGTTECFLLATMAYDRYVAICKPLLYPVIMNNSLCIRLLAFSFLGGFLHALIHEVLIFRLTFCNSNIIHHFYCDIIPL 189
gi 334346752 105 SFSATTECCLLAAMAYDRYVAICNPLLYPVVMTNRLCSQLSIFSYIVGVLHSMFHVGLLFRLSFCHSNKIQHFFCDIMPL 184
gi 317373404 105 CTVETADCFLLAAMAYDRYVAICNPLQYHIMMSKKLCIQMTTGAFIAGNLHSMIHVGLVFRLVFCGSNHINHFYCDILPL 184
gi 557267166 105 GVSATVECFLLAVMAYDRYIAICNPLLYRAVISTRVCMQLVIASYIGGFFHGILHMIGILRLSFYRSNVISHFFCDLPPL 184
gi 166215762 105 GSNATTECFLLVVMAYDRYVAICNPLLYPVVMSNSLCTQFIGISYFIGFLHSAIHVGLLFRLTFCRSNIIHYFYCEILQL 184
gi 47576333  105 CFSATTECFLLVAMAYDRYVAICNPLLYLVVMSNRLCIQFITVSYLIGFLHGLLHVGLLFRLTFCSSNVIDHFYCEILPL 184
gi 564246093 105 GALATTECFLLAVMAYDRYVAICSPLLYTTIMSCRVCVQLVSASYLGGFIHSAIHTGFTFTLLFCGPNEINHFFCDIPPL 184
gi 47577603  103 VSCGTTECFLLAAMAYDRYVAIYNPLLYAVSMSPRVYVSLIIASNVGGILHASIHTAATASLSFCNSNEIKHFFCDIPPL 182
gi 218512125 135 VTFGTTECFLLAAMAYDHYVAIYNPLLYSVSMSPRVYVPLITASYVAGILHATIHIVATFSLSFCGSNEIRHVFCDMPPL 214
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #  ### ### ##                                            #  ## ##  #  
gi 212276497 190 FMISCTDPsINFLMVFILSGSIQVFTIVTVLNSYTFALFTILKKKSVRGVRKAFSTCGAHLLSVSLYYGPLIFMYLRPAS 269
gi 334346752 185 YKISCTDPsINVLMVFIFSGSIQAFTILTILISYTCILFAILKKKSQKGRSKAFSTCGAHLFSVSLYFGSLLFMYVRPRS 264
gi 317373404 185 YRLSCVDPyINELVLFIFSGSVQVFTIGSVLISYLYILLTIFKMKSKEGRAKAFSTCASHFLSVSLFYGSLFFMYVRPNL 264
gi 557267166 185 LQLSCTDTfVNELIIFIVSGPIQIFTFLIVLLSYVYILSTILQMNSAEGRRKAFSTCTSHLLSVSLFYGSLFVYIQPHSS 264
gi 166215762 185 FKISCTNPtVNILLIFIFSAFIQVFTFMTLIVSYSYILSAILKKKSEKGRSKAFSTCSAHLLSVSLFYGTLFFMYVSSRS 264
gi 47576333  185 YTISCTDPsINALVAFIMAIFIQVNTFISIIVSYARVLFAILRTKSERGRRKAFSTCSSHLLSVSLFYGTLFIIYVLSGS 264
gi 564246093 185 IKLSCSDThVNEMVMFVATLLISGGSSLTILVSCGYILATILRIHSAEGRRKAFSTCTSHLTSVSIFYGSILCMYLQPAS 264
gi 47577603  183 LAISCSDTkMNELLLFVFVSSIEVLTILVIIISYSFILFAILKMHSAEGRQKVFSTCGSHLTGVSIYYGTILFMYMRPSS 262
gi 218512125 215 LAISCSDThTNQLLLFYFVGSIEIVTILIVLISCDFILLSILKMHSAKGRQKAFSTCGSHLTGVTIYHGTILVSYMRPSS 294
                        250       260       270
                 ....*....|....*....|....*....|....*....
Feature 1           ## ###  #  ##                       
gi 212276497 270 pqADDQDMIDSVFYTIIIPLLNPIIYSLRNKQVIDSFTK 308
gi 334346752 265 lqADNQDMMDSLFYTIVIPLLNPFIYSLRNKEVIEALRT 303
gi 317373404 265 leEGDKDIPAAILFTIVVPLLNPFIYSLRNREVISVLRK 303
gi 557267166 265 y-SLDHNMLDSLCYTIFIPMLNPLIYSLRNKEVKEAMRK 302
gi 166215762 265 gsAADQAKMYSLFYTIIIPLLNPFIYSLRNKEVIDALRR 303
gi 47576333  265 dtDNYQGKMYSLFYTIIIPLLNPFIYSLRNKEVIGALRK 303
gi 564246093 265 gySLEQDHLASVFYTLVIPMLNPLIYSLRNKDVKDAIKR 303
gi 47577603  263 syALEHDMVVSTFYAIVIPMLNPIIYSLRNKEVKEAMKR 301
gi 218512125 295 syASDHDIIVSIFYTIVIPKLNPIIYSLRNKEVKKAVKK 333

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap