Conserved Protein Domain Family
7tmA_OR5D-like

?
cd15410: 7tmA_OR5D-like 
olfactory receptor subfamily 5D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5D, 5L, 5W, and related proteins in otehr mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320532
View PSSM: cd15410
Aligned: 23 rows
Threshold Bit Score: 447.491
Threshold Setting Gi: 194685306
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                              #  ##     
gi 38372723   14 FILLGFSEYPEI-QVPLFLVFLFVYTVTVVGNLGMIIIIRLNSKLHTIMCFFLSHLSLTDFCFSTVVTPKLLENLVvEYR 92
gi 38372722   14 FALLGFTDYPKL-QIPLFLVFLLMYVITVVGNLGMIIIIKINPKFHTPMYFFLSHLSFVDFCYSSIVTPKLLENLVmADK 92
gi 47577281   14 FILLGFSEYPHL-HAPLFLLFFMIYAVTLFGNMGIIVARKINPKLHTPMYFFLSHLSFLDICYSTVFTPKLLEILIvENK 92
gi 38372718   14 FTLLGFSDYLEL-QIPLFFVFLAVYGFSVVGNLGMIVIIKINPKLHTPMYFFLNHLSFVDFCYSSIIAPMMLVNLVvEDR 92
gi 47577379   24 FILLAFSEFPNL-QLPLFLVFLIMYTVTVLENLGMIFVIRINPKLHTPMYFFLSHLSFVDFCYTSVIAPKLLDLLLvEDK 102
gi 585719723 145 FVLLGFSEYPDL-QVPFFLLFLTIYMVSVVGNLGMIMIIRISPKLHTPMYFFLSHLSFLDFCYSSVLTPKLLEVLVvEVG 223
gi 395544963  14 FILLGFSDYPEF-QIPLFLVFLAIYVISVMGNLGMIAIIVINSKLHTPMYFFLKHLSLVDFCYSTVVIPKLLENLLaEDR 92
gi 47577485   12 FLLLGFSDHPEL-QSLLFVVFFSIYSVTLMGNIGMILLITVSSNLHIPMYFFLCILSFIDACYSSVIAPKLLVNLIsDKK 90
gi 2495053    11 FILLGFPTRPEL-QIVLFLVFLTLYGIILTGNIGLMMLIRTDPHLQTPMYFFLSNLSFADLCFSSAIVPKMLVNFLsENK 89
gi 602668233  12 FILLGFSDHPESlQVILFLMFLIIYLMTLVGNLGIILLIKVESRLHTPMYFFLSHLSLIDICYSSSITPKLLIVTAsAVK 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              ###### ##  #                                            # #####           
gi 38372723   93 TISFSGCIMQFCFACIFGVTETFMLAAMAYDRFVAVCKPLLYTTIMSQKLCALLVAGSYTWGIVCSLILTYFLLdLSFCE 172
gi 38372722   93 SIFYFSCMMQYFLSCTAVVTESFLLAVMAYDRFVAICNPLLYTVAMSQRLCALLVAGSYLWGMFGPLVLLCYALrLNFSG 172
gi 47577281   93 TISFKGCMTQFFFICAFVITEMFMLAVMAYDRFVAVCNPLLYTVSMSPKLCAFLVAGTYMWGILCSMTITYSLLqLSYCG 172
gi 38372718   93 TISFSGCLVQFFFFCTFVVTELILFAVMAYDHFVAICNPLLYTVAISQKLCAMLVVVLYAWGVACSLTLACSALkLSFHG 172
gi 47577379  103 SISFEGCMVQYFLGCTFVITEMFMLAVMAYDRLVAVCNPLLYTAAMSQELCSILVVVTYIWAGIFSSTLTYILLqLSYCG 182
gi 585719723 224 TISFMGCMMQFFFGCTFVITEMFMLAAMAYDRFVAVCNPLLYTVAMPRKLCALLVAGCYVWGIVCSFVQTCFLMaLSFCG 303
gi 395544963  93 AMPFSICMTQFFFIANCALTDTFMLAVMAYDRFVAICNPLLYMVIMSPKRCTLLMATAYSWGTLFSLLFTYSLLvLSFCG 172
gi 47577485   91 VISYNGCATQLYFFCSLVDTESFLLSAMSYDRYIAICNPLLYTVIMSKRVCIQLAFGAFLGGTMSSIIHTTNTF-QLSFC 169
gi 2495053    90 SISLYGCALQFYFSCAFADTESFILAAMAYDRYVAICNPLLYTVVMSRGICVWLIVLSYIGGNMSSLVHTSFAFiLKYCD 169
gi 602668233  92 GISLFACALQMYLFIMFVVAESFLLAAMAYDRYVAICNPLLYTVIMSRNVCIFLVLSSYLWGIICALIHTISAF-RLPFC 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                #  ### ### ##                                           
gi 38372723  173 STFINNFICDHSVIVSASYSDPYISQRLCFIIAIFNEVSSLIIILTSYMLIFTTIMKMRSASGRQKTFSTCASHLTAITI 252
gi 38372722  173 PNVINHFFCEYTALISVSGSDILIPHLLLFSFATFNEMCTLLIILTSYVFIFVTVLKIRSVSGRHKAFSTWASHLTSITI 252
gi 47577281  173 PNIINHFGCEYSAILSLSCSDPTFSQVICLIISIFNETCSLLIILASYAFIVVTIIKMPSKGGLQKAFSTCSSHLTAISI 252
gi 38372718  173 FNTINHFFCELSSLISLSYPDSYLSQLLLFTVATFNEISTLLIILTSYAFIIVTTLKMPSASGHRKVFSTCASHLTAITI 252
gi 47577379  183 PNVINHFCCEYSALLSVSCSDISFSQTACLVISMFNEACCLLIIITSYVFIGVTIIKIPTKGAFQKALSTCASHLTAIGV 262
gi 585719723 304 SNTINHFGCEYSAVIAASCSDTRTNLMLSFVISTFNEASSLLIILASYVFIVVAIIKMPSTGGLRKAFSTCASHLTAITV 383
gi 395544963 173 SNIIDNFVCDYSALLSAACSDKHFSELILFIVSNFNMLSTLMVICSSYIFIFVTVMKMHSVRARHKAFSTCASHLTAVGV 252
gi 47577485  170 SKEINHFFCDISPLFSLSCSDTYTHDIILVVFASLVEALSLLTVLLSYMYIIVAIFKIGSAEGRKKGFSTCASHLTVITI 249
gi 2495053   170 KNVINHFFCDLPPLLKLSCTDTSVNEWLLSTYGSSVEIFCFIVIVISYYFILRSVLRIRSSSGRKKTFSTCASHLTSVAI 249
gi 602668233 171 GNTIHHFFCDVAPVLTLSCSDIQLNKMLLFIFATLVESSTIIIILMSYILIITCVSRIHSSKGKYKAFSTCVSHFTAISV 250
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
Feature 1         #  ## ##  #     ## ###  #  ##                         
gi 38372723  253 FHGTILFLYCVPNpKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDINNMFEKLV 307
gi 38372722  253 FHGTILFLYCVPNsKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDAFWKLI 307
gi 47577281  253 FHGIILLLYCVPNsKNSWLVVKVATVLFTVMIPMLNPLIYSLRNKDVKGTISRLM 307
gi 38372718  253 FHGTILFLYCVPNsKNSRHTVKVASVFYTVVIPLLNPLIYSLRNKDVKDAIRKII 307
gi 47577379  263 CHGIVLLLYCVLKsKSSLFLVKVATVFHSMVIPMLNPLIYSLRNTDVKETVRKLV 317
gi 585719723 384 FHGIILLLYCMPSsKNSLLLVKVATVLYTVVIPMLNPLIYSLRNNDVKEALRKIF 438
gi 395544963 253 FYGTVLFLYCIPNtKSTWFTKKMGSVFYAVVIPMLNPLIYSLRNNEVKETIRKLI 307
gi 47577485  250 YHGTLIFIYLRPStGHSMDIDKMASVFYTLIIPMLNPLIYSLRNKDVKFAFRKII 304
gi 2495053   250 YQGTLLFIYSRPTyLYTPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAAKRAV 304
gi 602668233 251 FHVTILLIYCQPNaSRGRDSNRIASVFYTVVIPMLNPLIYSLRNKEVKGAFQRLV 305

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap