Conserved Protein Domain Family
7tmA_OR5G-like

?
cd15414: 7tmA_OR5G-like 
olfactory receptor subfamily 5G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5G and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320536
View PSSM: cd15414
Aligned: 9 rows
Threshold Bit Score: 452.266
Threshold Setting Gi: 426258604
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                #  ##           ###### #
gi 166215773  25 IVLFFMFLFVYLITLGGNLGMITLIWIDPRLHTPMYFFLRHLSFVDICSSSSVVPKMLCNIFAEKKDITFLGCAAQMWFF 104
gi 48474536   25 VFLFLLFLLFYLVTMTGNLGMIILIRVDSRLHTPMYFFLSHLSFVDICFSSVVAPKMLTDFFADKKAISFLGCVLQQWFF 104
gi 341941205  25 IVLFLTFLCVYLATLLGNLGMIILIHQDTRLHIPMYFFLSHLSFVDACSSSVISPKMLSDIFVDKKVISFLGCAIQFCLF 104
gi 426258604  64 VCLFLLLLSFYLINLTGNLGTLVLIQMDSRLHXPMYFFHSHLSSMDMSFSSVVSPKMLSDFFVGRKAVSFQGCAWQQGRF 143
gi 345322649  25 IILFMLFLLYYLVTLVGNLGLIAPIGVDSRLRSPMYFFLSHLAFVDTCSSSTVVPKMLTDFFKEKKTISFLGCAAQMWFF 104
gi 637249211  35 IPFFIFFLVVYLFTLLGNLGMILLIRIDSQLHTPMYFFLSKLSFVDLCYSSVVTPKLLMDFVVKNNTISLGGCAAQMWFF 114
gi 564257190  25 IPLFVVFLVIYTITLIGNLGMIILIKVDPQLHTPMYFFLSNLSFVDVCYSSVVTPTMLVNFIAQRKAISLAGCATQMWFF 104
gi 602659712  25 ILLFVFFLIVYFITLLGNLGMFLLIQRDSRLHTPMYFFLSNLSLVDLCYSSVVTPKMLMDFVIESKTISLRGCAAQMWFF 104
gi 620956742  11 IPLSILFLMIYGMTLVGNLGIITLIGMDSRLQTPMYFFLSHLSFVDLCYSSVVAPKLLEILFTEKKAISFLGCAAQMWFF 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 166215773 105 GLFEAAECFLLAAMAYDRYVAICKPLLYTLIMSQQVCMQLVVGPYAMALISTMTHTIFtFCLPFCGSNIINHFFCDIFPL 184
gi 48474536  105 GFFVAIECLLLASMAYDRYVAICNPLLYSVAMSQRLCIQLVIGPYAVGFFNTMTHTTAaFRLPFCGSNIINHFFCDMSPI 184
gi 341941205 105 SQFVVTECFLLASMAYDRYVAICKPLLYTLIMSQRVCVQLVIGPYSIGLISTVVHTTSaFILPYCGPNLINHFFCDLLPV 184
gi 426258604 144 EFFIIAECFXLVSVAYGRCGYTRNPLLYSVAISQRLXVQLVVGPYVTGFLNPTMHXCDaFCLPFCSPDVIHHFFCDLPPL 223
gi 345322649 105 GLFVAAECFLFSAMAFDRYVAIRNPLLYRSFVSPEVRVRLAVAPYVLGFLSTTTHTTStFRLPFCGPDVINHYFCDIAPL 184
gi 637249211 115 GLFVAIECHLLASMAYDRYIAISKPLLYTVIMSRNVCIFLTAVPYLLGLLNGTVHTSL-TFQLIFCKATINHFFCDIPAV 193
gi 564257190 105 GLFVATECYLLAVMAYDRYVAISNPLLYMVLMSRRICAQLLAGPYIVGLVNAVMHTSF-TFHLSFCNRVINHFFCDIPAV 183
gi 602659712 105 GFFLGFECYLLASMACDRYVAISNPLLYRVIMSRKACMQLLVGPCFVGILNATTHTVM-TFQLTFCKSKINHFFCDIPVV 183
gi 620956742  91 GILVATECFLLAAMACDRYVAICSPLVYTIIMSPKTCIQLATAPYVIGLVNATIHTTAtFGLTFCGSRKINHFFCDIAPL 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #  ### ### ##                                            #  ## ##  #  
gi 166215773 185 LSLACADTWVNKFVLFVLAGAIGVLSGLIIMVSYICILMTILKIQTADGKQKAFFTCFSHLAAVSILYGTLFLIYVRPSS 264
gi 48474536  185 LSLICADIRINKLLVFIVAGAVLIVSSTTIIVSYFHILIAILRIRSAEGRRKAFSTCSSHVTAVSILYGTLFFIYVRPSA 264
gi 341941205 185 LSLACADTQMNKHLLFIMAGILGVFSGIIILVSYVYIAITILKINSADGRRKAFSTCSSHLTAVSILYGTLFFIYVRPSS 264
gi 426258604 224 LSLVCADTSLNKWVVFVVAGAEGVYSGLTVLGSSTGVLIPILKIHSADGRCEASSTCSARGAAMSILYGPLLFIYVRPSA 303
gi 345322649 185 LALVCADVQASRWLLFISAGTVGVSSGLAILVSYLYILVAVSRIRSATGRRKAFSTCSSHLTAVAVLYGTLFFIYVRPGA 264
gi 637249211 194 ISLSCSDTSFNLAVLFGLSFAQGTLSGCIVIISYIYILVATLKIRSTKGRWKVFSTCSSHLTAVSIFYGTLFFIYVRPSS 273
gi 564257190 184 ISLSCSDNHINKLVLFVLSGVLGTFSSLIVLASYIYILTAILRIRSAEGRCKAFSTCSSHLTAVTIFFGTLFFIYVCPSS 263
gi 602659712 184 ISLSCSEAQINKIVLFIMSCTLGTLSSCFVIISYIYILSAILRIRSAEGQRKAFSTCSTHLTAVSIFYGTLFLTYVRPSN 263
gi 620956742 171 LSLSCSSIQVNEILTLLMASLIGVLSGAVILISYTRIVSAILRIRSVEGRYKVFSTCASHLTSVIIFYGTLFFTYVRPPS 250
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
Feature 1           ## ###  #  ##                             
gi 166215773 265 ssSLGIYKVISLFYTVVIPMVNPLIYSLRNKeVKDAFRRKIERKK 309
gi 48474536  265 isSLDLNKVVSVFYTAVIPMLNPLIYSLRNKeVKSAMGRTVAKAK 309
gi 341941205 265 sfSLDINKVVSLFYTAVIPMLNPFIYSLRNKeVKDALIRTFEKKF 309
gi 426258604 304 wvSLGLDKVVSVVYTAGIPMLNPLTYCLRNK-VKDAIHRAVLKRT 347
gi 345322649 265 slSLHVNKVVSVFYTAIIPMLNPLIYSLRNKeVKDALCWTLQRKM 309
gi 637249211 274 gsTVEEDKVVSMCYTIMIPMLNPMIYSLRNKeVKDAVKRILRRKH 318
gi 564257190 264 hsSVDLDKVVSMFYTVVIPMLNPIIYSLRNKeVKDALRRVIGRKM 308
gi 602659712 264 sfLADQGKMFSMLYTVVIPMLNPLIYSIRNKeIQDAVGRVIRRKG 308
gi 620956742 251 --QDNADKVASVFYSLVIPMLNPLIYSLRNKeVNNSLRRMIARRR 293

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap