Conserved Protein Domain Family
7tmA_OR5J-like

?
cd15415: 7tmA_OR5J-like 
olfactory receptor subfamily 5J and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5J and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320537
View PSSM: cd15415
Aligned: 10 rows
Threshold Bit Score: 446.09
Threshold Setting Gi: 38372500
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                #  ##           ###### #
gi 38372500   25 AVLFVVFLVIYAITLLRNLGMILLIQITSKLHTPMYFLLSCLSFVDACYSSAIAPKMLVNLLVvKATISFSACMVQHLCF 104
gi 47577617   25 VFLFILFLLIYVISLVGNLGLFMLIHITPKLHTPMYHFLRSLSFVDACYSSVFAPTLLLNFFVeRERISFSACILQYFLF 104
gi 513186125  25 PPLFVVILLIYVITLVGNLIMISLITIDFQLQTPMYFFLINLSIVDLCYSSVFIPRMLVNFLVeNKTISYSGCLAQHFSF 104
gi 21928463   25 IPLFLLVTLIYFITLLDNLGIIILIWLNAQLHTPMYFFLGNLSFCDICYSTVFAPKMLVNFLSkHKSSTFSGCVLQSFPF 104
gi 557318176  22 QLRVFLFVLFFMIYVTTLVGNFGVIRVNPQLHTPMYFFLSNLSILDLFYSSVSAPRLLIDFLMeRKNISYGACIAQFYFF 101
gi 564232912  25 VPLFMVFFVIYTITVLGNLGMILLIRFNPQLYTPMYFFLSNLSFIDLCYSSVFAPRLLFDLIVgSKKVSYGACIAQTFLF 104
gi 541968139  25 TPLFIIFLMIYLVTLMGNLGLITLIETNPRLHTPMYFFLCNLSVVDLCYSSVFSPKLLIGFLMeKKTISYSACFAQHFFF 104
gi 602668245  25 VPLFMIFLLIYFLTLVGNMGMVVLIRISPQLHTPMYFFLGNLSVVDLCYSSIFAPRLLMNLAQ-FKTISYAGCITQHCFF 103
gi 483499629  25 VPLFFLFLGIYIITLLGNLGMIVLIWTHLQLHTPMYFFLSNLSLIDLCCSTVFVPRLLVSFLVqSKTISYSTCLSQIFFS 104
gi 620982314  25 VPLFMLFLAIYFVTLVGNIGMIVLIQVDSRLQTTMYFFLSNLSFLDLCYATVFAPKMLANYFSeKKTISFAGCFTQCFLF 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 38372500  105 GVFITTEGFLLSVMAYDRYVAIVSPLLYTVAMSDRKCVELVTGSWIGGIVNTLIHTISLRRLSFCRLNAVSHFFCDIPSL 184
gi 47577617  105 ASLLTTEGFLLAAMAFDRYMAIANPLTYTVAMTKLICVLLVLGSCLGGTITSLTHTIGLMNLCFCGPNVISHFFCDLPPL 184
gi 513186125 105 VVFVTTEGFLLAAMAYDRYVAICSPLLYTTLMARRVCVCLVVGSYLGGLCNSLVHTSGLLKLSFCGPNTINHFFCDTNPL 184
gi 21928463  105 AVYVTTKDILLSMMAYDHYVAIANPLLYTVIMAQKVCIQMVLASYLGGLINSLTHTIGLLKLDFCGPNIVNHYFCDVPPL 184
gi 557318176 102 ALLVATEAFLLAVMAYDRYVAICNPLLYTVAMPRRVCIQLVAGSYIGGLTNSLVHTCGLLGLSFCGPNVIKHFFCDLPPL 181
gi 564232912 105 GTFVSTEGFLLAAMAYDRYIAICNPLLYTVAMPKKVCVQLVAGSYMGGLLNSVSQVIGLLKLSFCGPNIINHYFCDIPPL 184
gi 541968139 105 LMFVTTEVFLLAVMAYDRYVAVCNPLLYTALMPRSVCTQLVAGSYIGGVLNSLIQTCCLLPLPFCGPNTINHYFCDTNPL 184
gi 602668245 104 VVFVSTEGFLLAVMAYDRYVAICKPLLYTTVMTKRVYVHLVAGSYLGGIVNSLTHTSGLLTLSFCAPGVINHFFCDTPVL 183
gi 483499629 105 AVLLTTEGFLLAAMAYDRYVAICRPLLYTTVMTKRVCRQLVVGSYMGGLLNSLTHTCGLLELPFCGPNLINHYCCDIPPL 184
gi 620982314 105 IMYVSSEGILLAVMAFDRYVAICNPLLYNIIVTKKLCINLVVGSYLGGIINSLSHTGSLLRLPFCGPNVVNHYFCDVPPL 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #  ### ### ##                                            #  ## ##  #  
gi 38372500  185 LKLSCSDTSMNELLLLTFSGVIAMATFLTVIISYIFIAFASLRIhSASGRQQAFSTCASHLTAVTIFYGTLIFSYIQPSS 264
gi 47577617  185 LKLSCSDTSMNELLLLVFSGVIAMTTLLTVVLSYIFIVAAILRIrSAAGRHKAFSTCASHLTAVTLFYGSISFSYIQPSS 264
gi 513186125 185 LELSCSDNHLNELVLVTLSGIVAMSTLLFVIISYLYILFSVLSM-GSASRYKAFSTCASHLTAVTLFYGPVSLSHVQPSS 263
gi 21928463  185 LRLSCSDAHINEMLPLVFSGLIAMFTFIVIMVSYICIIIAIQRIhAAEGRYKAFSTCVSHLTTVTLFYGSVSFSYIQPSS 264
gi 557318176 182 LELACSDTHKNETLLLVFSGAISAFSLSMIIISYLYILSAILRIrSAEGRRKAFSTCTSHLTAVTVFYGSITFSYLQPSS 261
gi 564232912 185 LKLACSDTHTHEVMLLAFTVAIAASTFMTILISYLYIVCAILRIrSAEGRRKAFSTCASHLTAVTVLYGSVTFSYVQPSS 264
gi 541968139 185 LKLTCSDNHLNELLLVTFNGTISMSVLFIIIISYVHILFSILRIrSAGGRRKAFSTCASHLLTITLFYVPAGLSHMQPGS 264
gi 602668245 184 LKVSCSHTHINELLLVTFSGVIAFSTLLIIIISYLCILFCIIKMhSCGSRYKAFSTCASHLTAVTMFYGPVSLSHLQVSS 263
gi 483499629 185 LQLACADTHHNETLLIAFSVVIALFTLFVIAVSYMLILSAILRIqSDDGRKKTFHTCASHLTAVTIFYGSVTFSYIQPSS 264
gi 620982314 185 LKLPCADTRINEILLFTLSGILAIITFLFVFISYIFIVATILRIpSTEGRQKAFSTCASHLTAVTLFYSSVSFSYVQPTS 264
                        250       260       270
                 ....*....|....*....|....*....|....*....
Feature 1           ## ###  #  ##                       
gi 38372500  265 QYFVEQEKVVSMFYTLGIPMLNLLIHSLRNKDVKEAVKR 303
gi 47577617  265 QYSLEQEKVVSIFYTLVIPMLNPLIYSLRNKDVKDAVKR 303
gi 513186125 264 RYSLEQEKISAVFYTLVIPMLNPLIYSLRNKEVKNALRR 302
gi 21928463  265 QYSLEQEKVLAVFYTLVIPMLNPLIYSLRNKDVKDAAKR 303
gi 557318176 262 SYSLEQEKVSSVFYSLVVPMLNPLIYSLRNKEVKDTLRR 300
gi 564232912 265 SYSMGQEKVCALFYTLVVPMSNPLIYSLRNKDVKDGLRR 303
gi 541968139 265 KYSVEMEKVTAVFYTLIVPMLNPLIYSLRNKEVKDALRK 303
gi 602668245 264 VYIQQQEKISAVFYTLVVPMLNPVIYSLRNKEVKDALKK 302
gi 483499629 265 SYSMEQEKISAVFYTLVVPMLNPLIYSLRNKEVRNSFRK 303
gi 620982314 265 LHSLDQEKVVAVFYTLVIPMLNPLIYSLRNKDVKEALKK 303

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap