Conserved Protein Domain Family
7tmA_OR5P-like

?
cd15416: 7tmA_OR5P-like 
olfactory receptor subfamily 5P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5P and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320538
View PSSM: cd15416
Aligned: 13 rows
Threshold Bit Score: 438.339
Threshold Setting Gi: 345322530
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                #  ##           ###### #
gi 20532191   25 AILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMYIFLCHLAFVDIGYSSSVTPVMLMSFLRKETSLPvagCVAQLCSV 104
gi 48474897   28 IVLFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASADIGYSSSVTPNMLVNFLVKQNTISyigCSIQFGSA 107
gi 48474549   25 AILFVFFLPVYIVTVVGNISIILLIRSSPQLHTPMYLFLSHLAFVDIGYSTSVTPIMLISFLREETTIPlagCAAQLGSD 104
gi 20532190   21 TDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLSHLAFADMAYSSSVTPNMLVNFLVERNTVSylgCAIQLGSA 100
gi 395543538  28 IILFVFFLGIYVFTVMGNFCTIILIRLSPQLHTPMYLFLSHLAFVDFWYSTGATPNMLANFLEEKNIITysgCVTQLCSL 107
gi 345322530  25 IPLFMLFLLIYAVTLLGNLLIVLIIRVSSQLHTPMYFFLSHLSFSDSCYSSSVTPKMLANFLADKKTISypgCVAQLCAA 104
gi 620960495  25 VIFFVLFLIIYIITVLGNLVIILLIRVHSQLHTPMYFFLCHLSFSDTCYSSSVTLNMLVSFLSVKKSISylgCAAQFCAI 104
gi 620960419  25 LIFFLIFLLVYSVTIMGNLCIIMLIRVSSQLHTPMYLFLSHLAFIDIWYSTSVTPEMLKGFLVGRDTISyagCAAQLCSA 104
gi 620960488  24 TVLFVVFLMIYSFTLLGNLAITLVIKINSHLHTPMYLLLSHLSLSDIGFSSSVTPKMLVNLLAERKTISfpaCAAQLFIG 103
gi 345322621  60 AILFGLFLVTYMITLMGNTGIIMLIRASPQLHTPMYYFLSHLSLSDMCYSSSVTPKMLENLLQGKRTISfggCALQFAVA 139
gi 620960490  25 VIFFLLFLVMYSVTLLGNLVIIILIRISSQLHTPMYFFLSHLSFSDTCFSSSVTPKMLVNFLAEKKTISypaCATQFWLA 104
gi 620960486  25 VILFGLFLVTYTVTLLGNCSIILLIRIHSHLHTPMYFLLSHLSFTDMCISSTATPKLLENSLMGKTSISymeCAVQFFIA 104
gi 564257684  25 ITLCFAFIMMYAFILGGNLATITLISSSPWLHTPMYFFLSHLAFADICISSSVAPKMLVGLFVGRTNISyigCAAQLTSI 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 20532191  105 VTFGTAECFLLAAMAYDRYVAICSPLLYSTCMSPGVCIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCDYSPL 184
gi 48474897  108 AFFGGLECFLLAVMAYDRFVAICNPLLYSTKMSTQVCVQLVVGSYIGGFLNASFATVSFLFLFFCGPNIINHFFCDFAPL 187
gi 48474549  105 VAFGTTECFLLATMAYDRYVAICSPLLYSTQMSPAICCFLLGASYLGGCMNASSFTGCFVNLNFCGPNKVNHFFCDLFPL 184
gi 20532190  101 AFFATVECVLLAAMAYDRFVAICSPLLYSTKMSTQVSVQLLLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPL 180
gi 395543538 108 VTFGATESFLLTSMAYDRYMAICNPLLYSVKMSDQVCLLLIVISYIGGCLNGVTYTGCLLNLSFCGPNVIDHFFCDFSPL 187
gi 345322530 105 ATFGVVEYCLLAAMAYDRYVAICKPLLYVVCMPQRLCALLVIASYLTSCLNTVVYTANVFSLTFCGSLEINHFYCDVPPL 184
gi 620960495 105 FTFGTNECLLLAVMAYDRFTAIRHPLLYTAMMTKKICTLLVASSYTGAGINALVETTSVFSLSFCGPNVMNHFLCDFHPL 184
gi 620960419 105 FAFGTSEGILLAMMAYDRYVAICNPLFYAISMSNRVCVQLITVSYVGGCLNALVFTTFVFNLVFCGPDEIDHFFCDFPPL 184
gi 620960488 104 ALFGGTECFLLAAMAYDRYAAICKPLIYLALMSEKKCLGLVALSYLASVINALMCTNWVFSLWFCGPNEINHFFCDSPAL 183
gi 345322621 140 ATFGTNECFLLAVMAFDRYSAICRPLLYPLIMSNKVRVQLVMASYVGSCVNAAIFESSVFSLSFCGPNEINHFYCDFPPL 219
gi 620960490 105 ATFGFSECFLLAVMAYDRYVAICSPLIYTLIMSEKTCASLVAASYVASFMNSLLCTYGVFSLFFCGPDQINHFYCDTPAL 184
gi 620960486 105 SIFGPAECLLLAAMAYDRYVAICKPLAYPAIMSKRFCLLMVVDSYLGSLLTAFVFTSNLFRLSFCGPNVINHFFCDFPPL 184
gi 564257684 105 VTFGIVECLLLAAMAYDRYVAICNPLLYKVIMSQNLCMWLVAVSYIGGCMNSMAFLTCVLSLSFQGTVELDHFFCDLPAL 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #  ### ### ##                                            #  ## ##  #  
gi 20532191  185 LKLACSHdfTFEIIPAISSGSIIVATVCVIAISYIYILITILKMHSTKGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKS 264
gi 48474897  188 IELSCSDvrISVLVTSFSAGTVTMLTVLVIAISYTYILITILKMRSTEGRHKAFSTCTSHLTAVSLFYGTITFIYVMPKS 267
gi 48474549  185 VKLSCGHayIAEISPSISSASVLVSTLSTIIVSYIYILHSILRMRSAEGRNKAFSTCTSHLTAVTLFYGTVLFVYVMPKS 264
gi 20532190  181 LELSCSDisVSTVVLSFSSGSIIVVTVCVIAVCYIYILITILKMRSTEGHHKAFSTCTSHLTVVTLFYGTITFIYVMPNF 260
gi 395543538 188 VKLSCYHafIAEILPAIYSAIIIAIALVTIIISYLYIFFTILSMSSTEGRHKAFSTCTSHLTAVTLFYGTIIFIYVMPTS 267
gi 345322530 185 LKLSCTEprLAQILPAASMAIIMLVTVLTTLISYVYILLAILKIQSSGGRQKAFFTCASHLMTVTLFYGTTMFIYLLPSS 264
gi 620960495 185 LQLSCSDisLAKVLNSFVSGIIVAITIPTVLISYLYILLAILKIPSTQGRRKAFSTCGAHLTAVALFYGTTTFVYVLPNS 264
gi 620960419 185 MEISCSDihLIQTLSSISAAIIILSTVPTIIISYVYILCAIMRIQASDGRQKAFSTCASHLTAVILYYGTITFTYVQPSS 264
gi 620960488 184 LKLSCSDthLAKIFPSISSGTVVTITIVIIVISYLYIVTAILRIHTTEGRHKAFLTCASHLMTVTLYYGTVTFIYVRHSS 263
gi 345322621 220 LELACSDprVAQILNSITSVLISLVTILIIAISYLCILSAILRIPSTEGRHKAFSTCASHLTAVTLFYGTATFIYTQPNS 299
gi 620960490 185 LKLSCSDiqLAKIFQSSSAGITVIITSGTIITSYVYILISILRMPTKGGRRKAFSTCASHLLVVTLFYGTVTFIYVMPNS 264
gi 620960486 185 LKLSCSDttLAKIIPSSFATLLILSTLAIIVVSYLYIMLAILRIKSSAGRGKAFSTCASHLTAVSLFYGSSAFIYMLPKS 264
gi 564257684 185 LKLSSTNitITCTRPSVLSGSILSVTLLIITFSYFCILSAILRIRCAHGRNKAFSTCASHLTAVTLFCGTVSFTYLQPDS 264
                        250       260       270
                 ....*....|....*....|....*....|....*....
Feature 1           ## ###  #  ##                       
gi 20532191  265 SYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGALKR 303
gi 48474897  268 RYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALRR 306
gi 48474549  265 SYSADQVKVASVVYTVVIPMLNPLIYSLRNKEVKEAMKK 303
gi 20532190  261 SYSTDQNKVVSVLYTVVIPMLNPLIYSLRNKEIKGALKR 299
gi 395543538 268 SYSTDQNKVVSVFYIVVIPMLNPMIYSLRNKEIKDALKR 306
gi 345322530 265 SFSMDQKKMVSVCYMILIPMLNPMIYSLRNKEVKDAVLK 303
gi 620960495 265 RDTLEQNKVFSVFYIIVIPMLNPFIYSLRNREVKGTLRR 303
gi 620960419 265 SRSLEQNKIVSLFYTVVIPMLNPLIYTLRNKDVKRALMK 303
gi 620960488 264 NYSMDQNKVVSVFYLVVIPMLNPLIYSLRNKKIMGTLRR 302
gi 345322621 300 RYSMDQKKVVSVFYMVVIPMLNPLIYSLRNKDVKEALRR 338
gi 620960490 265 DNSVDLNKMVSVFYMVMIPMLNPVIYCLRNKDVIEALKR 303
gi 620960486 265 KYSMDQKKVVSMFYMVVIPMLNPLIYTLRNKEVKEALKR 303
gi 564257684 265 NISMDQAKIVSVFYVLVIPMLNPLIYSLRNKEVKDAVER 303

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap