Conserved Protein Domain Family
7tmA_OR5A1-like

?
cd15417: 7tmA_OR5A1-like 
olfactory receptor subfamily 5A1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5A1, 5A2, 5AN1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320539
View PSSM: cd15417
Aligned: 26 rows
Threshold Bit Score: 410.881
Threshold Setting Gi: 514788063
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                #  ##           ###### #
gi 38372702   28 ALLFVTFLGIYLTTLAWNLALIFLIRGDTHLHTPMYFFLSNLSFIDICYSSAVAPNMLTDFFwEQKTISFVGCAAQFFFF 107
gi 620976778  26 IFLFVLFLAIYLVTLTWNLGLTSLIKVSPSLHIPMYFFLRHLSFIDMCYSSSVIPKMLSDFFkEQKTISVLGCATQYFVF 105
gi 557318232  25 VTLFVLFLTIYFITVVGNLGMIFLIRSSPRLHTPMYYFLGNLAFVDFCFSTVVTPKMLADMFvERKAISYNGCVAQVFIL 104
gi 557323586  25 VTFFVLFLAIYIITLVGNLGMIILFRIDPQLHIPMYFLLSNLAFVDILYSTCITPKLLSDLIaERRAISYSACVSQLCIV 104
gi 530606601  25 ILLFMIFLVIYIITLLGNLGMITLVKIDPRLHTPMYYFLSNLAFVDLCYSTVVAPKMLVDLLaERKAISYTGCAAQICVF 104
gi 557323588  25 VMLFMLFLGIYLTTMVGNLGIIFLIRADYQLHTPMYYFLGNLAFVDICYSTLITPKLMADLItKRKAISYAGCAVQVFTL 104
gi 514788063  11 LALFTAFLVVYLMTLLGNLGIIILIRTSPQLHSPMYYFLGNLALVDLLYSTVVTPKLLSDLV-RQKPLSYVGCVTQVFVF 89
gi 557318238  24 IPLFLLFLAIYLITMVANIGLIFLIRVDSRLHTPMYFFLHYLAFVDLCYSTVIAPKMLADFLtERKNISYIGCGVQVFLF 103
gi 449283440  25 VTFFLMVLLVYLATILGNLGMIVLIMASPQLHSPMYYFLANLALIDVGSSTVITPKMLADFVsEEKVISYAGCVAQEFIY 104
gi 483499642  32 AALFLLFLLIYIVTILANLGMLALIAASPRLHTPMYYFLGNLAFVDLCSSTVITPKLLADFLsEKKLVTYAGCVAQVFIF 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                            # #####                         
gi 38372702  108 VGMGLSECLLLTAMAYDRYAAISSPLLYPTIMtQGLCTRMVVGAYVGGFLSSLIQASSIFRLHFCGPNIINHFFCDLPPV 187
gi 620976778 106 SGLGLTECCLLAAMAYDRYAAICTPLLYTTVMsPSLCRKMVAAAYAGGFLSALTETGLIYRQDFCGPNVIHHFFCDLLPL 185
gi 557318232 105 CFFGVTECFLLATMAYDRYVAICRPLVYSIILsPRLCVQLVVGSYFAGWINAMSQTVDLLQLSFCGSHVIDLFFCDISPL 184
gi 557323586 105 SILLVMECFLLAVMAYDRYAAICNPLLYTVMS-PRLCGQLVAGSFFTGCMNAMIQAVGMLKMSFCGPMVIDLFFCDISSM 183
gi 530606601 105 CMLIVTECFLLAAMAYDRYVAICNPLLYRVVMcPRLCAQLMAGSFLAGCVNSMAQTTGMLTLTFCGSNVIDLFFCDISPL 184
gi 557323588 105 CLFGVTECILLATMAYDRYVAICTPLVYSVIMsPRLCVQLVIGSFLAGWVNAVTQTAGMLQLTFCGSNVIDLFFCDISPL 184
gi 514788063  90 SIFLVTECFLLATMAYDRYMAVSHPLHYSVLMsPRLCVQLVGGSYLAGLLNGMGQTIGMLNLSFCGSVVVNLFFCDLSLL 169
gi 557318238 104 GVFVVTEGFLLATMAYDRYVAISSPLLYSVIMsPKLRVWLVIGSFLIGCVNGMTQTVNLLYLSFCGSKVIDHFFCDISPL 183
gi 449283440 105 SILGMTEVFLLAVMAYDRYLAICRPLLYHSVMsPERCFQLVTGSYLVGLTNGIGQTVGMFTLSFCGSSVIDLYFCDISPL 184
gi 483499642 112 DILGVTECFLLAMMAYDRYMAICHPLLYSVTMsPKCCFQLVTCSYLLGLTNGVGQTIGMLRLSFCSSRVIDHFFCDISPL 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #  ### ### ##                                            #  ## ##  #  
gi 38372702  188 LALSCSDTfLSQVVNFLVVVTVGGTSFLQLLISYGYIVSAVLKIpSAEGRWKACNTCASHLMVVTLLFGTALFVYLRPss 267
gi 620976778 186 LALSCSDTsTTQVVVFVVGVVIGMMSVLVVFLSYGYITVAVLLIrSARGRYKTFTTCASHLITVILFYGSGFFVYMRLns 265
gi 557318232 185 LSLSTSDAsISQMVLLTTAAILGAFTILVVLISYTFIVATILKIhSTEGKHKAFSTCASHLTVVSIFYGTSLFMYLKSss 264
gi 557323586 184 ILLSCSDTrIHHVILLFVTFLFGVVSTLIVLISYIFIISTILKIrSAEGKCKAFSTCASHLTAVIIFYGTGLFIYLQPnt 263
gi 530606601 185 LSLANSDSsINHVVLLAVTYLTGVFSGLIVLISYVFILNAILRIrSAEGRFKAFSTCTSHLTAVTIFYGSGLFIYLQPst 264
gi 557323588 185 LSLSNSDTtINHIVILVVTVVFGVFSILIVLISYIFILSTILRIhSTKGKCKAFSTCASHFMAVSVFYGTCLCIYLKSns 264
gi 514788063 170 ASLSSSDStLTSLIMTVPTFLFGVSSSLIVLVSYIAIVSTILSIrSAKGKCKAFSTCASHLTTVSIFYGNGLFVYLKPss 249
gi 557318238 184 ISLSESDStINQIILLASATLFGLSSGVIVLISYIFILSTILRIhSTEGKHKAFNTCTSHLTAVCILYGTALFVYLKPss 263
gi 449283440 185 ISLSTSNT-TISLIILTSAALFAVSNSLFVLVSYMAIISTILSIhSAEGKRKAFSTCASHLTTVSIFYGAACFTYLKPss 263
gi 483499642 192 ISLSTSDTtLNQIMLRTLASLFGVSSGLVVLLSYIAIISTILSIrSAKGKCKAFSTCASHLAVVSIFYGTAIFMYLKA-- 269
                        250       260       270
                 ....*....|....*....|....*....|....*....
Feature 1           ## ###  #  ##                       
gi 38372702  268 syLLGRDKVVSVFYSLVIPMLNPLIYSLRNKEIKDALWK 306
gi 620976778 266 sySESRDKVVSLFYTVVIPMLNPLIYSLRNREILDTLKR 304
gi 557318232 265 ddSQHEDKWTTVFYTVVTPMLNPLIYSLRNKDVKDAMRK 303
gi 557323586 264 knSRDQNKVVSVFYTVVTPMLNTLIYSLRNKEVKNAFNR 302
gi 530606601 265 kySRDQDKVVSVFYTVVTPMLNPLIYSLRNKEVKDALRR 303
gi 557323588 265 nnSQAKDKVLSVFYTVVTPMLNPLIYSLRNKEVKDALRK 303
gi 514788063 250 lkSREEDKWVAVLYTVVTPMLNPLIYSLRNQEVKEALRR 288
gi 557318238 264 kdSKPEDKWAPVFYTVVTPMLNPLIYSLRNKEVKDALKR 302
gi 449283440 264 -dSSRGDKWAVMLYTVLTPMLNPFIYSLRNKEVKEALRR 301
gi 483499642 270 --SSRDDKRAAVLYTVVTPMLNPLIYSLRNQEVKEALRR 306

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap