Conserved Protein Domain Family
7tmA_OR9G-like

?
cd15418: 7tmA_OR9G-like 
olfactory receptor subfamily 9G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 9G and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320540
View PSSM: cd15418
Aligned: 8 rows
Threshold Bit Score: 437.676
Threshold Setting Gi: 543748325
Created: 17-Jan-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                 #  ##           ###### 
gi 212276456  39 QPILFGVFLMLYLITLSGNMTLVILIRTDSHLHTPMYFFIGNLSFLDFWYTSVYTPKILASCVSEDKRISLAGCGAQLFF 118
gi 190359933  23 QLGLFVVFLGVYSLTVVGNSTLIVLICNDSHLHTPMYFVVGNLSFLDLWYSSVYTPKILVICISEDKSISFAGCLCQFFF 102
gi 637249221  24 QLILFVVFLNIYLLSLVGNITLIALICNSSRLHTPMYFFIGNLSFLDLWYSSVYTPKIIMNCISDDKSISFGGCLPQFFF 103
gi 602650166  25 RIILFVVFLVSYTLTLTGNLGLMALIYLDSRLHTPMYYFVGSLSFLDIWYSSVYTPRILYDCVSKNNHISLAGCAAQFFF 104
gi 543748325 219 QLLLFPVFTLIYIITLVGNVTLIMVIHRSSQLHTPMYFFIGNLSFLDLWYSSIYIPKILLNCISEDKSISFAGCAAQFFA 298
gi 557286701  25 QVTLFVIFLFSYILTLMGNLGLTALICLDLRLHTPMYFFVGSLSFLDTWYSSVYTPRILADCISKSKIMSYTGCVIQYFF 104
gi 557286763  30 RAALFVIFLCTYTLTLMGNLGLMVLIFLNSCLHTPMYFFVGNLSFLDTWYSSVYMPRILVDCISKSNVISYAGCAAQFFF 109
gi 557286769  30 QAFLFFAFLLSYILTLMGNLGLIILIFLNSCLHTPMYFFVGSLSFLDMWYSTVYTPRILADCMVKSKIISYAACATQFFF 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ##  #                                            # #####                        
gi 212276456 119 SCVVAYTECYLLAAMAYDRHAAICNPLLYSGTMSTALCTGLVAGSYIGGFLNAIAHTAntFRLHFCGKNIIDHFFCDAPP 198
gi 190359933 103 SAGLAYSECCLLAAMAYDRYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKktFSFNFCCENIIDDFFCDLLP 182
gi 637249221 104 SAGSAYSECYLLAAMAYDRYIAIANPLAHTHAMSNKVCMGLVALSYLFGFMNATIMTTetFTLSFCDXKVIDDFFCDLPP 183
gi 602650166 105 SAGLGWSECFLLAFMAYDRFVAICNPLLYTTAMPKKLCLVLGAYVVGFANSIAHTANT--FCLRFCGSNVINHYFCDVPP 182
gi 543748325 299 SAGSAGIECYLLAAMAYDRYVAISNPLLYTAVKSKKLCMGLVAASYLTGFANSILITSrtFNLSFCDSNIIDDFFCYLPP 378
gi 557286701 105 SAAVVHTECFLLAAMAYDRYVAICNPLLYSSAMTKKLCIQLVASSYAVGFANAIAHTGnmFRLRFCGDNTINHFFCDALP 184
gi 557286763 110 SAGLAHTECFLLAAMAYDRYVAICNPLLYSSVMTRKLCSQLVAGSYVAGFINTIVHTGntFRLHFCGDNTIDHFFCDVPP 189
gi 557286769 110 SVFLAQSECFLLAVMAYDRYVAICNPLLYSSIMTRSFCFQLVAASYAAGFTNAIVHTSntFHLHFCGDNIIDHYFCDALP 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #  ### ### ##                                            #  ## ##  # 
gi 212276456 199 LVKMSCTNTRVYEKVLLGVVGFTVLSSILAILISYVNILLAILRIHSASGRHKAFSTCASHLISVMLFYGSLLFMYSRPs 278
gi 190359933 183 LVKLACGEKGCYKFLMYFLLASNVICPAVLILASYLFIITSVLRISSSQGRLKAFSTCSSHLTSVTLYYGSILYIYALPr 262
gi 637249221 184 LVKLACNVPRSYQSVLYFILVLNVISPSALILASYAFILAAILRIRSTKGRQKAFSTCAAHLTAVTLYYGSILFIYSRSs 263
gi 602650166 183 LVKMACDDTQVYELILTALIGFNLLAATAIIVKSYIGIVAAIVRIHSAAGRRKAFSTCSAHLLSVSLFYGSMLIIYSTPn 262
gi 543748325 379 VVNLSCDVTDSYQLLLYFILTYNIIIPSVLNLTSYASILATVLKMRSAVGQWKAFSTCATHLTSVTIYYSSILFIYARP- 457
gi 557286701 185 LMKLACDDIRVYEIILAAIVGCNVGTAIVLVLCSYTAIVAAIVRIHSATGRRKAFSTCSAHLVSVTFFYGSHLFIYLRPs 264
gi 557286763 190 LMKMACDNTQVYEFILTAAVGFSVVATTALILGSYTGIVAAILRIRSATGRHKTFSTCSAHLISVLLYYGSLLFMYLQPr 269
gi 557286769 190 LMKMACDDTHVYNLILAITLGCNMVAITALILGSYTAILAAIFCIHSHSGRHKAFTTCSAHLISISLFYGSIFIMYLQPs 269
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
Feature 1            ## ###  #  ##                        
gi 212276456 279 STYSLERDKVAALFYTVINPLLNPLIYSLRNKDIKEAFRKA 319
gi 190359933 263 SSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEALKKL 303
gi 637249221 264 SSYALERDKVVSVFYTVVFPMLNPLIYSLRNKEIKDVLKKL 304
gi 602650166 263 SQHTPNWDKANALFYTVVNPLVNPLIYSLRNKDVKAAFKKA 303
gi 543748325 458 SSSFVGRNKVVSVFYTVVIPMLNPFIYSLRNQEVKEALKRL 498
gi 557286701 265 SQHTPEGDKVAALFYTVVNPLLNPVIYSLRNKDVKEALKKA 305
gi 557286763 270 SLHTPDRDKVTAVFCTVVNPLVNPLIYSLRNKDVKEAFRTT 310
gi 557286769 270 SQHIPDWDKVGALFYTVVNPLVNPIIYSLRNKDVKKALKTV 310

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap