Conserved Protein Domain Family
7tmA_OR5AP2-like

?
cd15943: 7tmA_OR5AP2-like 
olfactory receptor subfamily 5AP2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5AP2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320609
View PSSM: cd15943
Aligned: 13 rows
Threshold Bit Score: 469.922
Threshold Setting Gi: 641779415
Created: 12-Dec-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                              #  ##     
gi 37081351   17 EFLLLGLSDNPDLQGVLFALFLLIYMANMVGNLGMIVLIKIDLCLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLMAENK 96
gi 530606770  11 EFIFLGLTDNPELQVPLFTVFLVIYLITLIGNLGMIVLIRSDPQLHTPMYFFLINLSLVDFCYSSVITPKLLVGFLAGNK 90
gi 301608368  11 EFILLGLTDNPKLQIILFVLFFLFYIVTLLGNIGIIVAVRLDSRLHKPMYFFLNNLSFLDLCFSTTITPKTLVTFLSETK 90
gi 557318190  11 EFVLKGFTGHPEMQVILFTVFLVIYVITLMGNLGMIVLIKSNFQLHTPMYFFLCHLAFVDACYSSVVTPKMMVNFLAESK 90
gi 558134059  11 EFILLGFTGDLTTQVALFVVFLGIYLITLVGNLGMIALIHLDSRLHTPMYFFLGNLSFSDLCYSTVVVPKTLANFLAEKK 90
gi 641779415  11 EFILLGFTSSPELRALLFALFLVSYVTVLLGNAGLLLVIHLDARLHTPMYLFLRHLSFVDLCYSSAIVPKALNSFVMGNG 90
gi 620982333  25 EFILVGLIDNPDMKVIGFLTFFMIYLVTLIGNLGLITVIKADAQLHTPMYYFIGHLAFLDLCYSSAVLPKILDNLLAQNE 104
gi 557326283  11 EFILSGLTDGPQMKALCFVMFLLMYLVILIGNLGMIVLIRSASQLCTPMYFFLSHMSFLDLVYSSAVAPKMLLNLLTQKN 90
gi 602669892  11 EFVFVGLLDSPKMKPLCFIVILIIYLITLTGNLGMIVLIRISSQLQSPMYFFLSHLSFLDFGYSSAIAPKMLANLLAEKK 90
gi 620960472  11 EFILMGLTNLPEFQLLLFSVFLAIYLISLLGNLGLIVLIAVDSRLHTPMYFFLGNLSALDLSYSSAIAPKMLAGFFLEAR 90
gi 620960470  17 EFILLGLTDNTRIKIACFMTFLGMYLVTLVGNLGMILLIWIDPRLHSPMYFFISHLSLVDLGYSSAVTPHMLSDFLRKGK 96
gi 327260512  11 EFILLGLTDRAELKSALFAVFLIMYLIIVVGNLGMITLIKVDPRLHTPMYFFLSHLAFLDFSYSSAIMPKALINLLVENK 90
gi 558110593  11 EFLLSGLTESPEMKAICFLLFLVMYLVTLVGNLGMIVLIRVDSRLHTPMYYFLSNLEFVDFCYSSTITPKMLVDFLSERR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              ###### ##  #                                            # #####           
gi 37081351   97 AISFHGCAAQFYFFGSFLGTECFLLAMMAYDRYAAIWNPLLYPVLVSGRICFLLIATSFLAGCGNAAIHTGMTFRLSFCG 176
gi 530606770  91 VISFNGCATQFFFFSSFVGIECLLLAVMAYDRYVAICNPLLYTVIMSHRVCVLLVAGSFLAGFVNSMIHSICMFQLPFCA 170
gi 301608368  91 TISYYECALQMYFFAASATIECFLLGVMAYDRYVAICKPLLYSVIMSKRLCVQLVLASYILGYLNATLHTICTFRLPFCK 170
gi 557318190  91 VISFTGCAMQFCFYAGLAGTEYFLLSVMAYDRYVAICKPLLYTVVMSRRMCICLVSVSCGCSFLNSVTHIISTFQLPFCG 170
gi 558134059  91 AISFIGCATQFYFYAVFATVECLLLAAMAYDRYAAICNPLLYPVVMSQKVCIWLVVASYLVGCTNGLIHTNTTFRLPFCA 170
gi 641779415  91 TISFLGCAVQFCVFGGMLTTECCLLAVMAYDRFVAVCKPLLYTVTMSDGVCTRLLACSYASGFLNSLIQTLCTFSLPFCG 170
gi 620982333 105 TISFNGCAAQMYFLIVPASSECYLLAAMAYDRYVAICNPLLYSFIMSQGVCYLLVAGSYLVGFISATTQTYLTFRLSFCG 184
gi 557326283  91 NISYMGCAAQMFFFVFSASTECLLLAVMAYDRYVAICSPLLYMALMSPRVCCQLMASSYLFGFVNAMTQAFSTFRLSFCS 170
gi 602669892  91 SISYTHCAAQMYFFIFCASTECILLAAMAYDRYVAICNPLLYVVTMSPKVCTMMVAGSYLIGLVNAVTQTASTFQLSFCG 170
gi 620960472  91 TISLIECAIQMYLFVACVTTECYLLAVMAYDRFMAICNPLLYMVIMSPRVCIQLMLGSYLIGFLQGLVQVLLIFRLPFCK 170
gi 620960470  97 SISFSGCAAQMYFFVISASTECYLLAAMAYDRYVAICNPLLYVVTMSPKICAQLVIGCYFMGFVNATTQTVLTFRLPFCA 176
gi 327260512  91 TISFSGCAAQMYSFIAFGTTECFLLAAMAYDRYVAICKPLLYNVIMSRQLCLQLLIGSYICGFAISMIHTGCAFRLSFCH 170
gi 558110593  91 AISFGGCVTQLFCFVLTASVECLLLAVMAYDRYVAICNPLLYTVIMSRRVCAQLVSGSYLIGFVHALAQTISTFRLSFCN 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                #  ### ### ##                                           
gi 37081351  177 SNRINHFYCDTPPLLKLSCSDTHFNGIVIMAFSSFIVISCVMIVLISYLCIFIAVLKMPSLEGRHKAFSTCASYLMAVTI 256
gi 530606770 171 SNIINHFFCDVPPLLKLSCADTFINEVVIFAFASLIEISCLLTVLISYLYILSAILRIRSTEGRHKVFSTCASHLTAVTV 250
gi 301608368 171 TNKIDHFYCDVPPLLKLSCTKTTMNEILMFIFGGFAETSSLTTIMVSYSYIISTILRIRSSDGRKKAFSTCASHLVAVTI 250
gi 557318190 171 SNAINNLFCDITPLLKLSCASTQVNEIVVFASACLLGICSCLTIFLSYFYILSSLLRIHSSEGRRKAFSTCTSHLMAVTV 250
gi 558134059 171 SNVIDHFFCDVPLILKLSCSDTLVNQVLLFVISSLIGLFSFLTIFVSYVYILVNILRIHTAEGRHKAFSTCASHLMAVTL 250
gi 641779415 171 ANQVDHFFCDITPLVKLSCTETRSNETIILASACVIGVSSFLTTLISYLYIFMAILRIPSLQGRRKTFSTCTSHLTAVSI 250
gi 620982333 185 SSVINHFVCDVPPLLALSCSATYVNEFVLFIFAIFLGVVTSSEILVSYICILCAILRIQSAKGRQKAFSTCATHLCSVVL 264
gi 557326283 171 SNIINHFFCDIPPLLALSCSDIHINKIVLSIFAMFLGLFTSAEILLSYVFIVSTILQIHSSEGKRKTFSTCASHLMAVSI 250
gi 602669892 171 SNVINHFFCDVPPLLSLSCTDTSINEMVLFVFATILGIFTSTEIVVSYAFILSAILRINSAEGKQKAFSTCASHLAAVTI 250
gi 620960472 171 SNIINHFFCDLPPILKLSCSNTFPNEVLLFSLGFFNGTVTSLEIMVSYVYILITILKIRSAAGRSKAFSTCASHLTAVGL 250
gi 620960470 177 SNVINHFFCDLPPLLELSCSDTHMNETVLLLFAIFLGVFTSLEILLSYIFILATILRIGSAEGRRKAFSTCTSHLAAVTI 256
gi 327260512 171 SNVIHHFFCDVIPLLNISCTDTRVNEIILFAFCIFNGVFITLEICISYIYIFSAILKIHSSEGRHKAFSTCTSHLIVVAM 250
gi 558110593 171 SKVINHYFCDIPPLIQLSCSETYSNELVLYTFGTFHGIFTSVEILVSYVYIISTILRIHSSGGRRKAFSTCASHLMAVMI 250
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
Feature 1         #  ## ##  #     ## ###  #  ##                         
gi 37081351  257 FFGTILFMYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLKNKDVKKALKKIL 311
gi 530606770 251 FFGTTLFMYLRPSSSSSMDRDKVVSVFYTVVIPMLNPLIYSLRNKEVKDALRRGF 305
gi 301608368 251 FYSTVLFMYLRPASAYTMSQDRIASVFYSVLIPMLNPLIYSLRNNEVAQALRKIK 305
gi 557318190 251 FYGALLFIYLRPSSSHTQDKDKVASVFYTVIIPMLNPMIYSLRNKEVKDALRKAL 305
gi 558134059 251 FYTTILFIYLRPSSSYSEGQDQVAAVFYTVVIPMMNPIIYSLRNKEVKDALWRIV 305
gi 641779415 251 FFGTLIFMYLRPKPSYSAQQDKAVSVLYTLVIPMVNPMIYSLRNKEVKEALRRRL 305
gi 620982333 265 FYGTSTFIYTRSASDYSLGQDKVISVFYTVVIPMLNPMIYSLRNQEVKRALKRII 319
gi 557326283 251 FFGTTVFMYLRPSSSYFSDQDKWASMFYTVVIPMMNPLIYSLRNKEVKEALKKIQ 305
gi 602669892 251 FYGTTVFMYLRPSSSYVLDQDKWASIFYTIVIPMLNPLIYSLRNKEVKNGLRRRQ 305
gi 620960472 251 LYGTAIFIYVRPSSQYAPENDKVVSVFYTLVIPMLNPLIYSLRNKDVKDALWKIT 305
gi 620960470 257 FYGTTVFMYMRPSSSYSLDSDKVTSVFYTAVIPMLNPVIYSLRNKEVKNAMSRLI 311
gi 327260512 251 FFGTAVFMYMRPSSASSPDKDRVVSVFYTVVNPMLNPLIYSLRNKEVKNALRRVF 305
gi 558110593 251 FYGTTVFMYVRPISSYSLDRDKVVSVFYTVVIPMLNPLIYSLRNKEVKDALKRLL 305

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap