Conserved Protein Domain Family
7tmA_OR5AR1-like

?
cd15944: 7tmA_OR5AR1-like 
olfactory receptor subfamily 5AR1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5AR1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320610
View PSSM: cd15944
Aligned: 6 rows
Threshold Bit Score: 450.776
Threshold Setting Gi: 564248026
Created: 12-Dec-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                             #  ##      
gi 37081363   12 FIFMGITQDPQMEIIFFVVFLIVYLVNVVGNIGMIILITTDTQLHTPMYFFLCNLSFVDLGYSSAIAPRMLADFLTNHKV 91
gi 558134034  12 FILLGFTQEPQTQDILFVVFLLIYLTNVVGNLGMIFMITVDSQLHTPMYFFLCNLSFCDFGYSSAIAPKMLVGFLHGRQA 91
gi 557318212  12 FVFLGFTDDPQLQLVLFVVFLVIYLINLLGNLGMIFLIIFDSQLHTPMYFFLSHLSLVDLGYSTAIAPRMLSDFLHQHKV 91
gi 557318224  12 FFLLGITDDPQMQVIFFVVFLSIYLVNVIGNLGMIILISHDHRLHTPMYVFLWHLSFCDLCYSSAIAPRMLADFLSKERA 91
gi 564248026  12 FILLGFTEDPYTQTILFIVFLVIYLVNVVGNLGMILMITTDSQLHTPMYKFLRHLSFCDLCYSTTTVPKLLAGFVSQRQT 91
gi 355771085  12 FIFMGITQDPQMQIIFFVVFLIVYLVNVVGNVGVIIPIITDTQLHTPMYFFLCNLSFVDLGYSSAIAPRMLADFLTKHKV 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             ###### ##  #                                            # #####            
gi 37081363   92 ISFSSCATQFAFFVGFVDAECYVLAAMAYGRFVAICRPLHYSTFMSKQVCLALMLGSYLAGLVSLVAHTTLTFSLSYCGS 171
gi 558134034  92 ISFAGCTMQFLFFGVFMNTGFYTLAAMAYDRYVAICNPLLYSTTMCRRVCVQLVVASYLASAVNILINTGATFSINFCSS 171
gi 557318212  92 ISFAGCATQFAFFVGFVDAECYVLASMAYDRYVAICRPLHYATLMSKRVCGVLVAGSYLAGLVSLAAHTSLTFSLSYCGS 171
gi 557318224  92 ISFSGCSAQFYFFAAFVDTECYVLAVMAYDRCVAICNPLLYSSAMSKKLCIQLLAGSYIAGMTNAVIHTTATFSLNFCGS 171
gi 564248026  92 IPFSGCAAQFFFFAVFVTASIYILAAMAYDRYVVICNPLLYSMKMSNRVCAQLIAACYSASCVNAIIHTGATFSLSFCSS 171
gi 355771085  92 ISFSSCATQFAFFVGFVDAECYVLAAMAYDRFVAICQPLHYSTLMSKQVCLALMLGSYLAGLVSLVSHTTLTFSLSYCGS 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                               #  ### ### ##                                            
gi 37081363  172 nIINHFFCEIPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYTFILVAIIRMRSAEGRLKAFSTCGSHLTGITLF 251
gi 558134034 172 nVINHFFCDVPPLLAISCSDTHVNELLLYFFAGLAEMSSLSIILVSYVFILVAILRMRSAEGRHKAFLTCASHFTGVSLL 251
gi 557318212 172 nIINHFFCEIPPLLALSCSDTYVSEILLFSLCGFIEFSTILIILISYLFIFDSILRIRSAAGRKKAFSTCASHLIGVTLF 251
gi 557318224 172 nIVNHFFCDVPPLLSLSCSDTHINEILLFAFAGFVEMSSLSVILISYLFILSAILRTRSAEGRHKAFSTCGSHFAGVTLF 251
gi 564248026 172 -KVNHFFCDMPAVLALSCFDTHINEILLYVFGSFVEIISLSIIFTSYLLIMIAILRIRSAQGRRKAFLTCASHFTGVTLL 250
gi 355771085 172 rEINHFFCEVPALLKLSCTDTSAYETAMYVCCIMMLLIPFSVISASYTRILMTVYRMSEAEGRRKAVATCSSHMVVVGLF 251
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
Feature 1        #  ## ##  #     ## ###  #  ##                         
gi 37081363  252 YGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPMLNPLIYSLRNKDVKAAFKKLI 305
gi 558134034 252 FGTIIFMYLRPTSVYSLDQDKWASVFYTVVIPMLNPLIYSLRKKDVKEAFRKIM 305
gi 557318212 252 YGTVMFMYLRPTSSYSLDQDKWASVFYTVVIPMLNPLIYSLRNKDVKAAFKKLI 305
gi 557318224 252 YGTVIFMYLRPTSVYSLDQDKWASVFYTVVIPMMNPLIYSLRNKDVKEAFKKLI 305
gi 564248026 251 FGTIIFMYMRPTSTYSFDQDKWASVFYTIVIPMLNPLIYSLRNKNVKDAFRKIF 304
gi 355771085 252 YGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGALQKVV 305

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap