Conserved Protein Domain Family
7tmA_OR5C1-like

?
cd15945: 7tmA_OR5C1-like 
olfactory receptor subfamily 5C1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
This group includes human olfactory receptor subfamily 5C1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.
Statistics
?
PSSM-Id: 320611
View PSSM: cd15945
Aligned: 8 rows
Threshold Bit Score: 419.534
Threshold Setting Gi: 431893535
Created: 12-Dec-2014
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                             #  ##      
gi 38372754   16 FVLLGITNRWDLRVALFLTCLPVYLVSLLGNMGMALLIRMDARLHTPMYFFLANLSLLDACYSSAIGPKMLVDLLLPRAT 95
gi 483495688  14 FILLGFSDHLEVELPLFGLFLLIYITTLVGNAGIIVLVWLNACLHSPMYYFLSNLSFLDLSYSSAIAPKMLLNLLAQRKT 93
gi 431893535  12 FLLVGFTDYLPLGITLFLVFFIAYILTVVGNVGLIILVNIDSNLQTPMYYLLSNLSFLDICYSTSITPKMLVNFLTTRKS 91
gi 602665567  13 FILLGFTSQRSLQLLLFSFFLPIYLLSVAGNLGLVILIRVERALHTPMYYFLSHLALMDLCSCCTVAPKMLLGLLKGYDT 92
gi 38372640   12 FLFVGFTDYLPLRVTLFLVFLLVYTLTMVGNILLIILVNINSSLQIPMYYFLSNLSFLDISCSTAITPKMLANFLASRKS 91
gi 47577719   12 FILVGITNDPSMKVVLFVAFLLIYLIILVANIGMIVLIKLDSQLRTPMYFFLCHLSFSDICYSTAVGPKMLVDLLTKCKS 91
gi 47577707   12 FFLLGITSNYDMKIVLFMVFLLVYLSILLENVGMITLIRMDSQLHTPMYFFLSHLSFSDLCYSTAVGPRMLVDLVAKKHS 91
gi 74762590   12 FFLLGITNNPEMKVTLFAVFLAVYIINFSANLGMIVLIRMDYQLHTPMYFFLSHLSFCDLCYSTATGPKMLVDLLAKNKS 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             ###### ##  #                                            # #####            
gi 38372754   96 IPYTACALQMFVFAGLADTECCLLAAMAYDRYVAIRNPLLYTTAMSQRLCLALLGASGLGGAVSAFVHTTLTFRLSFCRS 175
gi 483495688  94 ISFFGCATQMFLFAALADAECLILAVMAYDRYVAICHPLLYTITMSRQACAFMVAGAYLSGVLTSLVHTSFVFTLSFCGS 173
gi 431893535  92 ISPYGCALQMIFFCCFADAECLILAAMSYDRYAAICYPLLYPTLMSRRVCIYFIVSAYFSGSRTSMVHVCLTFRLPFCGS 171
gi 602665567  93 IPIPACALQMFFFAAASDAECCLLAVMAYDRYVAICRPLHYGTAMPPHLCHLLVVASYVAGMASGVIHSSMAFRLPFCCA 172
gi 38372640   92 ISPYGCALQMFFFASFADAECLILAAMAYDRYAAICNPLLYTTLMSRRVCVCFIVLAYFSGSTTSLVHVCLTFRLSFCGS 171
gi 47577719   92 ISFGGCALQFFFTCIFIDAECVLLAVMAFDRYKAISNPLIYAVDMSSRFCYQLLAGVYILAMIDTLMHTIMTFELCFCRS 171
gi 47577707   92 IPFIGCFLQLLFVCVFIDVECMLLAVMAFDRYKAISNPLLYAVDMSTKVCYQFLTLIYMASAADGLIHTTLAFSLCFCGS 171
gi 74762590   92 IPFYGCALQFLVFCIFADSECLLLSVMAFDRYKAIINPLLYTVNMSSRVCYLLLTGVYLVGIADALIHMTLAFRLCFCGS 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                   #  ### ### ##                                        
gi 38372754  176 RKINSF-FCDIPPLLAISCSDTs---LNELLLFAICGFIQTATVLAITVSYGFIAGAVihmrsvEGSRRAASTGGSHLTA 251
gi 483495688 174 NTINHF-FCDIPPLLELSCSKTh---INEVLLFTLCGFIQTSTFLIIIISYACILGTIlqfhatESRHKAFSTCTSHLMA 249
gi 431893535 172 NIINHFiFSVIFHLFWRADTHInellLFALCSLALMHIKMRYTFCIIMISYIRIIIAIqrirsaEGRRKAFSTCASHLTT 251
gi 602665567 173 NTLDHF-FCDIPPVLALACADTq---INQLLLLVVCGTIQSITLMAIITSYGLILCTVg----rTRTWRAMSTCGSHLTA 244
gi 38372640  172 NIVNHF-FCDIPPLLALSCTDTq---INQLLLFALCSFIQTSTFVVIFISYFCILITVlsikssGGRSKTFSTCASHLIA 247
gi 47577719  172 NKINHF-FCDLPPILLLSCSDIy---VNELAMFVFSGFVELCTISGLLVSYCYIITSVlkissdEGRFKAFSTCASHLTA 247
gi 47577707  172 TEINHF-FCDLPPLYLLSCSDTq---TNELVVFTLFGFIELSTILSVLVSYCYIISSVlkisssGGRFKAFSTCASHLTA 247
gi 74762590  172 NEINHF-FCDIPPLLLLSRSDTq---VNELVLFTVFGFIELSTISGVFISYCYIILSVleihsaEGRFKALSTCTSHLSA 247
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
Feature 1            #  ## ##  #     ## ###  #  ##                       
gi 38372754  252 VAMMYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKEVKEALRQ 307
gi 483495688 250 VGLFYGSLFFTYLRPSSSYSPDTDKIIAVFYTVVFPMLNPMIYSLRNKEVMEALRR 305
gi 431893535 252 VTLFYGSVTFSYMQPSSRYSLEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKDAAKR 307
gi 602665567 245 VGVLYGTLIFMYLRPDGTYTPQTDKMTSLFYTVAIPTLNPAIYSLRNTKVNQAVKK 300
gi 38372640  248 VTLFYGALLFMYLQPTTSYSLDTDKVVAVFYTVVFPMFNPIIYSFRNKDVKNALKK 303
gi 47577719  248 VAIFQGTLFFMYFRPSSSYSLDQDKIASLFYTLVIPMLNPIIYSLRNKDVKEALYK 303
gi 47577707  248 VGILQGTTLFMYFRPSSAYSLDQDKMTSVFYLLIIPMMNPLIYSLRNKDVKEALIR 303
gi 74762590  248 VAIFQGTLLFMYFRPSSSYSLDQDKMTSLFYTLVVPMLNPLIYSLRNKDVKEALKK 303

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap