2VT4,2Y00


Conserved Protein Domain Family
7tmA_Beta1_AR

?
cd15958: 7tmA_Beta1_AR 
Click on image for an interactive view with Cn3D
beta-1 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors
The beta-1 adrenergic receptor (beta-1 adrenoceptor), also known as beta-1 AR, is activated by adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of beta-ARs can lead to cardiac dysfunction such as arrhythmias or heart failure.
Statistics
?
PSSM-Id: 320624
View PSSM: cd15958
Aligned: 5 rows
Threshold Bit Score: 505.976
Threshold Setting Gi: 192988268
Created: 18-Sep-2014
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:2VT4: Meleagris gallopavo beta-1 adrenergic receptor binds cyanopindolol, contacts at 4A.
    View structure with Cn3D
  • Structure:2Y00: Meleagris gallopavo beta-1 adrenergic receptor binds partial agonist dobutamine, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                   ##              #   #
2VT4_A        12 AGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLD 91
2Y00_A        12 AGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLD 91
gi 48429211   59 AGMGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVD 138
gi 3023364    36 MGMTMFMAAIILLIVMGNIMVIVAIGRNQRLQTLTNVFITSLACADLIMGLFVVPLGATLVVSGRWLYGSIFCEFWTSVD 115
gi 432922318  36 AGMSLVMALIVLSIVFGNILVILAIARTQRLQTLTNVFIVSLASADLIMGLLVVPFGAVLEVRGLWLYGSFFCEIWTSVD 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #  #                                                                            
2VT4_A        92 VLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDedp-qalKCYQDPGCCD 170
2Y00_A        92 VLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDedp-qalKCYQDPGCCD 170
gi 48429211  139 VLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAesd-earRCYNDPKCCD 217
gi 3023364   116 VLCVTASIETLCVISIDRYIAITSPFRYQSLLTKGRAKGIVCSVWGISALVSFLPIMMHWWRDtgdplamKCYEDPGCCD 195
gi 432922318 116 VLCVTASIETLCVIAIDRYVAITSPFRYQSLLTKSRAKAVVCVVWAISALVSFLPILMHWSRDsm---dtDCYENPQCCD 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        # #   ##  ##  #                                                                 
2VT4_A       171 FVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDraskr--------------------------------- 217
2Y00_A       171 FVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDraskrk-------------------------------- 218
gi 48429211  218 FVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDscerrflggparppspspspvpapapppgpprpaaaaa 297
gi 3023364   196 FVTNRAYAIASSIISFYFPLIIMIFVYIRVFKEAQKQMKKIDkcegrfshshvlsh------------------------ 251
gi 432922318 193 FVTNRAYAISSSVISFYIPLVVMIFVYARVYREAKKQLKKIDkcegrfhntltgl------------------------- 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                               #  ##  #               #  ##  #          
2VT4_A       218 --------------krvmlMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIY 283
2Y00_A       219 -------------tsrvmlMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIY 285
gi 48429211  298 taplangragkrrpsrlvaLREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFVFFNWLGYANSAFNPIIY 377
gi 3023364   252 ------grssrrilskilvAKEQKALKTLGIIMGTFTLCWLPFFLANVVNVFYRNLIPDKLFLFLNWLGYANSAFNPIIY 325
gi 432922318 248 ------tskckkrpskilaLREQKALKTLGIIMGTFTLCWLPFFIVNVVRVFCAELVDKNVFVFLNWLGYVNSAFNPIIY 321
                        330
                 ....*....|
Feature 1                  
2VT4_A       284 CRSPDFRKAF 293
2Y00_A       286 CRSPDFRKAF 295
gi 48429211  378 CRSPDFRKAF 387
gi 3023364   326 CRSPDFRKAF 335
gi 432922318 322 CRSPDFRKAF 331

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap