1ZVO


Conserved Protein Domain Family
IgC_CH3_IgD

?
cd16094: IgC_CH3_IgD 
Click on image for an interactive view with Cn3D
CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin
IgC_CH3: The third immunoglobulin constant domain (IgC) of delta heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Statistics
?
PSSM-Id: 319343
View PSSM: cd16094
Aligned: 5 rows
Threshold Bit Score: 188.907
Threshold Setting Gi: 82704381
Created: 5-May-2015
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
homodimer
Conserved site include 1 residue -Click on image for an interactive view with Cn3D
Feature 1:homodimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                              #                        
1ZVO_C      403 KLSLNLLASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQPATY 482
gi 106368   400 KLSLNLLASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQPATY 479
gi 244188   400 KLSLNLLASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQPATY 479
gi 495871   273 KLSLNLLASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPRSTTFWAWSVLRVPAPPSPQPATY 352
gi 82704381 268 KLSLNLLASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQPATY 347
                        90       100
                ....*....|....*....|
Feature 1                           
1ZVO_C      483 TCVVSHEDSRTLLNASRSLE 502
gi 106368   480 TCVVSHEDSRTLLNASRSLE 499
gi 244188   480 TCVVSHEDSRTLLNASRSLE 499
gi 495871   353 TCVVSHEDSRTLLNASRSLE 372
gi 82704381 348 TCVVSHEDSRTLLNASRSLE 367

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap