Conserved Protein Domain Family
EFh_SPARC_TICN2

?
cd16238: EFh_SPARC_TICN2 
EF-hand, extracellular calcium-binding (EC) motif, found in testican-2 (TICN2)
TICN2, also termed SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2 (Spock2), is an extracellular heparan sulphate proteoglycan expressed in brain, lung, and testis. It inhibits neurite extension from cultured primary cerebellar neurons and may play regulatory roles in the development of the central nervous system. It also participates in diverse steps of neurogenesis. Moreover, TICN2 may contribute to ECM remodeling by regulating function(s) of other testican family members, which possess membrane-type matrix metalloproteinases (MT-MMPs) inhibitory function. Furthermore, TICN2 corresponding gene SPOCK2 acts as a susceptibility gene for bronchopulmonary dysplasia. TICN2 contains an N-terminal signal peptide, a testican-specific domain followed by a follistatin-like (FS) domain, an extracellular calcium-binding (EC) domain including a pair of EF hands, a thyroglobulin-like domain (TY), and a C-terminal region with two putative glycosaminoglycan attachment sites. The substitution of a ligating Asp residue by Tyr292 in the +Y position of EF-hand 2 in TICN2 could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ ion with low affinity.
Statistics
?
PSSM-Id: 320017
View PSSM: cd16238
Aligned: 4 rows
Threshold Bit Score: 230.979
Threshold Setting Gi: 543745311
Created: 18-Nov-2014
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Feature 1:putative Ca binding site [ion binding site]
Evidence:
  • Comment:Based on the structure evidence how the first EF-hand motif in Homo sapiens SPARC (1SRA) binds Ca2+ ion.
  • Comment:Unlike other members in SPARC family, the substitution of a ligating Asp residue by Tyr292 in the +Y position of EF hand 2 in testican-2 could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ with low affinity.
  • Citation:PMID 8119487

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                   #   #      #         
gi 24212500  199 CTGQDLADLGDRLRDWFQLLHENSKqngsassvagpasgldkslgasCKDSIGWMFSKLDTSADLFLDQTELAAINLDKY 278
gi 82183882  197 CTGQDLADLGDRLRDWFQLLHENSKqnntsnpgsiqvnvldkslvagCKDSIGWMFSKLDSNNDLFLDQAELTAINLDKY 276
gi 528498308 194 CTGQDLADLGDRLRDWFQLLQGNGKqnstgspaassasivdrtlvatCKDSIGWMFSKLDTNSDLYLDQAELAAINLDKY 273
gi 543745311 314 CTGQDLADLGDRLRDWFQLLRENAKqngsgglpaspatalersvaasCKEAVGWMFARLDTSGDLFLEAAELAAINLDKY 393
                         90       100       110
                 ....*....|....*....|....*....|..
Feature 1                                        
gi 24212500  279 EVCIRPFFNSCDTYKDGRVSTAEWCFCFWREK 310
gi 82183882  277 EICIRPFFNSCDTYKDGRVSTAEWCFCFWREK 308
gi 528498308 274 EVCIRPFFNSCDSYRDGKVSTAEWCLCFWREK 305
gi 543745311 394 EVCIRSFFNSCDTSRDGRVSAPEWCFCFWREK 425

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap