3IUZ


Conserved Protein Domain Family
VOC_like

?
cd16349: VOC_like 
Click on image for an interactive view with Cn3D
uncharacterized subfamily of the vicinal oxygen chelate (VOC) family
The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Statistics
?
PSSM-Id: 319959
View PSSM: cd16349
Aligned: 19 rows
Threshold Bit Score: 481.416
Threshold Setting Gi: 861970802
Created: 7-Dec-2015
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Conserved Features/SitesClick to see Conserved Features Help
 
metal binding
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1: metal binding site [ion binding site], 4 residue positions
Conserved feature residue pattern:H H T EClick to see conserved feature residue pattern help
Evidence:
  • Comment:by similarity to other members of this superfamily

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                    #                                   
3IUZ_A        38 GRATRAEIAQALNXVLFAGILdrVPTGRAYTDDVAATGGXVVFDHGALRTVXWRd--NGALPEGEAAFTRILRPLGYRLN 115
gi 504031179  41 TKVSRAVIAQALNMLLFADLIerVPAARKYVQHCLAHNRTVMHDHGAVRTIAMEg--MGALPAGQASITRILQPLGYSLK 118
gi 388531128  43 DRASRAVIAQALNMLLFADLIdrVPAAAAYVAERVAAGGTLCHDHGAVRTVAMAg--QGALPAGEAAITRILEPLGYAQV 120
gi 928484616  41 QAVHRAWLAEALNLCLLHKLVdaVPDGRRYVEEQALQGRKVVFDHGAIRTVDWPa--NGELPRGRQAFSRLLEPLGFTDV 118
gi 861970802  46 DRASRAQVAMALNAALFLDLLdrVPTAARYVSEMREKGEAIVFDHGALRTIAGE---TGALPSGHEAFLRFLAPLGYEVR 122
gi 822051672  41 GTVSRASFAMALGTVLFGVSMdnVPSGADYVGEQLAAGRRIILDHGALRTIRFAegpTGALPAGQDAFARILGPLGYEIA 120
gi 947155378  43 ATVSRAVFAQAMNAALFADLLdrVPSARFYVEDVLASGAAVRFDHGALRTVRLPsgaTGALPAGEQAFRRILEPLGYRVA 122
gi 499714686  40 EPLNRAVIAQAMNMMLFDDLLerVPEGKQYVAEKLASGEKVVFDHGALRTVAWE---NQALPMGYKAFARILEPLGFTVA 116
gi 861974302  41 DTVSRAAFAMALNVALFADLLrrVPSGDAYVTDTVARGGKVIFDHGALRSIRFPngpTGALPGGEDAFTRIFLPLGYTMA 120
gi 930028294  45 NGIDALRFAEALNLVLFADLLkrVPEGAEYVDECVAQGRRIVLDHGALRTVLLPqgaRCAMPQGVEAFRRVLEPLGYVEV 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3IUZ_A       116 GNYPLDRISXTGRSYAHaDAPEGIAQFFVSEFHPERFSDAFREAVGRVTGNSADPLTPRaqtllwqldrdGVLTVADGAE 195
gi 504031179 119 GLYPLERLKMTGRSYAQvEYPEAIAQFFISELHPERFSPEFQEALGRIVSSSVDPLTHEakalldelessHSLSVDQAAA 198
gi 388531128 121 GHYPLDRLKMTGRSYAQkDLPEDIAQFFVSELHPERFGPDFEAAVLRVTGSSRDPLTAEaaaaldrlaaeGTLDIETATA 200
gi 928484616 119 RTYPLTRLNMTGWGYRQmDLPEDIAQFFVSELHPGRFSQTFQQAVTRVVGSSLDPLQAEhtrilkrlsltRHCRLDEAQA 198
gi 861970802 123 GLYPLPALTMTGRAFVQtDLPETVPQFFVSELHIDQLAPPAQDAAARIFGASSDPLGEAewlalnaigrhSDCTIADGIT 202
gi 822051672 121 RQYPLKRLKMTGHAWRHcDFPEDIPQYFVSELHVDQFDEDFGAAAQRVFGTSRDPLGAEakavldayaqgKAVSFAQASE 200
gi 947155378 123 DVYPLPKLRMTGHAFRHlDHPETIPQFFVSELDVSAFDPAFGAAATRTFGTSRDPLTADhlallarfettGTAPFDDAVA 202
gi 499714686 117 GQYPLPKLKMCGFVYTHaDLPRDIAQYFVSELYPEQFTKSFQDAVDRVVSVSSDPLTPRsaellqklaanGVLPLADAAE 196
gi 861974302 121 AIYPLDRLKMTGRAYRHsDFPEAIPQFFLSELHVDRFDAEFAEAAGRVFGTSRDPLNDQakdvlaryegdSPVQLVDAIA 200
gi 930028294 125 GIYPLPRLKMTGHVWCHaKLPETMPQFFVSELHVDQFSPAFAKAAVRVFGPALDRLDAAtaqvlsrfaagGSVPQDDAVA 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                  # #                                   
3IUZ_A       196 LIGLLVPCFERQHGVPRLADYETLLRESAEXAWIATEGNAFNHATDRVDDVFGLSEQQXALGRPXXDXVEVSgSGRVXQT 275
gi 504031179 199 LLPVLVSCFGRQHGNISLADYTVLLNESAEAAWISTEGNVFNHVTDRVEDVDALAEEQKALGQPMKATVEKSqSGRVRQT 278
gi 388531128 201 LLPVLVACFDRQHGVPALADYEALKAQSAEMAWIATEGNAFNHATDRVADVDALAEAERAAGRPIKDKVEVSaSGRVRQT 280
gi 928484616 199 LLPALYRAFGRQHGTVLEADYHCLLSESAEMAWIATEGNSFNHLTDRVQDLEACVAQQRDLQRPMKDSIEVSaSGRVMQT 278
gi 861970802 203 ILKGALAAFARQHPAPALEDYQTLLEHSKEGAWIATEGNAFNHATTRVADVQAHSEELKAAGYPLKPAVEISrNGRVRQT 282
gi 822051672 201 ALPAIASAFAVQHEPAHIDDYEALLAQSAEAAWIATEGNSFNHATDRVADVVALADALRVAGKPIKDSVEVSaSGRVRQT 280
gi 947155378 203 GLSGIVAAFACQHDTPAAHDYDILRAASAEAAWIATEGNSFNHVTDRVEDVEALADRQRAMGRPVKDTVEVSaSGRVRQT 282
gi 499714686 197 LLPNLLQCFDRQHGVPHLHDYLALREESAEMAWISTEGNAFNHATDRVGDIRQLDAQQRELGRPMKDEIEVArNANIMQT 276
gi 861974302 201 ALPVILSAFDRQHEAPVFADYQLLLSRSNEAAWIATEGNGFNHATDRVADVAALAERLKGEDRPMKAKLEVSaTGRVRQT 280
gi 930028294 205 ALKVVMGLFDRQHPVPFESDYEILRAESAEAAWIATEGNAFNHVTDRVADVEATAQGERVAGRSIKDKVEVSaSGRVRQT 284
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
Feature 1                                    #                                     
3IUZ_A       276 AFRADTVRRQFIGAqgetVERDVPGSFYEFITRDRFad--apAASPRVDLGFDAGNAQGIFXXTAA 339
gi 504031179 279 AFHAAQVSRPFLAEdgsvVEKEVPGSFLEFITRLSLpd--evDGKKVLDLGFDSSNAQAIFKMTAN 342
gi 388531128 281 AYRAAEVARPFRDAagatVTRIVPGSFYEFITRDPLpdtlatETGRRLDLGFDSSNAQGIFKMTAA 346
gi 928484616 279 AYRACTVTRGLIDAdghyREHQVPGSFVEFIERKVD------PENGRIDLNFDSSNAQGIFKMTDS 338
gi 861970802 283 AILADKVARPFRLAdggeTSQDVPGSFYEFITRDID------PETGKLDLTFDSGNATGIFAVTRG 342
gi 822051672 281 AFRADSVERIFRTDdg-eIRRTVPGSFFEFISRDPL------PGSGGLDLAFDSANATGIFAMTRA 339
gi 947155378 283 AYRADAVTRRFRHDdgtiEERVVPGSFYEFISRDID------PDTGLLDLRFDSANATGIFAMTTA 342
gi 499714686 277 AYRATKVKRQFKTDqg-vETHEVPGSFFEFIQRNDIn----eSAEKGMDLRFDSSNAQGIFTMTRA 337
gi 861974302 281 AFRADSVERLFADG----ELRQVPGSFYEFISRDID------PATGRLDLAFDTGNATGIFAMTSA 336
gi 930028294 285 ALRAAQVKRSFRAEdgtlTAQTVPGSFFEFITRRAD------PATGKLDLTFDSGNATGIFKMTAA 344

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap