Conserved Protein Domain Family
DMSOR_beta_like

?
cd16370: DMSOR_beta_like 
uncharacterized subfamily of DMSO Reductase beta subunit family
This family consists of the small beta iron-sulfur (FeS) subunit of the DMSO Reductase (DMSOR) family. Members of this family also contain a large, periplasmic molybdenum-containing alpha subunit and may have a small gamma subunit as well. Examples of heterodimeric members with alpha and beta subunits include arsenite oxidase, and tungsten-containing formate dehydrogenase (FDH-T) while heterotrimeric members containing alpha, beta, and gamma subunits include formate dehydrogenase-N (FDH-N), and nitrate reductase (NarGHI). The beta subunit contains four Fe4/S4 and/or Fe3/S4 clusters which transfer the electrons from the alpha subunit to a hydrophobic integral membrane protein, presumably a cytochrome containing two b-type heme groups. The reducing equivalents are then transferred to menaquinone, which finally reduces the electron-accepting enzyme system.
Statistics
?
PSSM-Id: 319892
View PSSM: cd16370
Aligned: 21 rows
Threshold Bit Score: 156.279
Threshold Setting Gi: 169637196
Created: 15-Jan-2016
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Fe-S cluster
Feature 1:Fe-S cluster binding site [ion binding site]
Evidence:
  • Comment:predicted based on similar proteins.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #      #### ##   #   #           # #             #  ####     #   ##  ##      
gi 913268218   3 KILKTDGMNKCIGCFTCMLVCSGVNqq---nhSISKSAIKIRTsGGLQGKFVVDVCIACkdERACAEACPSGALEKR-PG 78
gi 206891084   1 MPVFVKDNEKCVGCLICMFACGRAHqa----aGLESSCIKVRSqGGISRGFSVFVCRGCd-DPPCARACPEDALIVR-KT 74
gi 52549648    3 KKLAVLDVNKCIGCMECMFACTRREgr----aGFDKSAIRVRSaGGIERGFVVVVCRACe-YPPCAKVCPTDALRLR-NG 76
gi 931376145   2 ARLHVVDLERCVGCQLCMFACHRRFgk----gGLGKSAIFVRSrGGMSRGFTVIVCRACe-DPPCAAVCPVDALQLG-KK 75
gi 119525839   2 PRLVIVDVDKCVGCMSCMFACSRRFge----gGLAKSAIHVSSiGGVERGFKVVVCRACe-NPPCAAVCPTNALVRR-EG 75
gi 260865725   3 RAIRVKDPDRCIGCYSCMLACARLVhr---shSLTKSAIRVQTrGGLQSKWGIDVCRACp-DAPCAEACPTGALTPR-AG 77
gi 332178993   1 MRIEIKDPDRCVGCEICMLACVRRQgf----aGLAKSKIAVHSsGGMEKGFTVLVCRACf-DPPCAAVCPTNALEVR-KD 74
gi 973146977   4 KVLQVINRDRCLGCLSCMYACSRRLkn---igGTGKSAMRVRPyTGTEGIFSIRVCMRCe-DPDCAAACPTGALEVA-PV 78
gi 157314803   3 KKLVVKDRERCIGCYSCMYACSRAWhn---iiGIEKSAMRVKNyPGVEGAFSVRICQACl-EPECAEICPTGALKLSkKG 78
gi 973012192   2 KRLVVEDIEKCVGCGLCMFACSRKFakrpeigNSSSAILPVSL-SGFERGATIIFCRACe-EPPCVQVCPTGALKPK-KG 78
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
Feature 1          #         ####   ### ##        # #####  #   #    #    
gi 913268218  79 GGVVLKKDKCIGCKKCVDACIVSAVHFDDDeHKPIICKHCGVCAKFCPHECLRMED 134
gi 206891084  75 GGVLLKEERCTGCGYCVKACILDAIGWNNGkNKPVICIQCGECAKSCHYKVLEFVR 130
gi 52549648   77 GGVILDKDKCIGCGFCAQACIMGAIFWDDElDKPIVCKYCGDCADYCVHNAIGLVD 132
gi 931376145  76 GGVVLQPQKCIGCGNCKDACTIGAVFWDEDaNKPVICIHCGYCTKYCPHGVIALLD 131
gi 119525839  76 GGVVLNPSKCVGCGNCARACPIGAVQWDYEsMKPIICVHCGYCVNYCPYGVLSLSR 131
gi 260865725  78 GGVIWRRNKCSRCGNCANACVLRVIHFDEE-GYPIICLYCGHCARFCPQEVIVWEE 132
gi 332178993  75 GGVNLISEKCIGCKNCVEACTVNAVFWDSEtNKPNICTYCGFCAMNCPHHVLYFNK 130
gi 973146977  79 GGVRLDKDKCTSCGACVKACTIAALQWDEEeGVPIPCIHCGQCVRYCPNEVIAMVE 134
gi 157314803  79 YGVELDRKKCTHCMRCVKACSAGALQWDDEtQMPLPCYHCGVCVMYCPTNVLDMQE 134
gi 973012192  79 GGVVYLENLCLGCHYCVEACTLNAIFVRED-GKIAVCIHCGYCASYCPHGVIAYKE 133

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap