Conserved Protein Domain Family
RING-H2_Pep3p_like

?
cd16462: RING-H2_Pep3p_like 
RING finger, H2 subclass, found in Saccharomyces cerevisiae vacuolar membrane protein PEP3 (Pep3p) and similar proteins
Pep3p, also known as carboxypeptidase Y-deficient protein 3, vacuolar morphogenesis protein 8, vacuolar protein sorting-associated protein 18 (Vps18p), or vacuolar protein-targeting protein 18, is a vacuolar membrane protein that affects late Golgi functions required for vacuolar protein sorting and efficient alpha-factor prohormone maturation. It is required for vacuolar biogenesis caused hypersensitivity to heat shock and ethanol stresses, probably due to disappearance of normal vacuoles. As a component of the homotypic fusion and vacuole protein sorting (HOPS) and class C core vacuole/endosome tethering (CORVET) complexes, its overexpression shortens lag phase but does not alter growth rate in Saccharomyces cerevisiae exposed to acetic acid stress. Moreover, Pep3p forms the Class C Vps protein complex (C-Vps complex) with Pep5p (also known as Vps11), Vps16, and Vps33, and is necessary for trafficking of hydrolase precursors to the vacuole by promoting vesicular docking reactions with SNARE proteins. Pep3p contains a C3H2C3-type RING-H2 finger at the C-terminus.
Statistics
?
PSSM-Id: 319376
View PSSM: cd16462
Aligned: 28 rows
Threshold Bit Score: 59.1647
Threshold Setting Gi: 612389971
Created: 7-Aug-2015
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Zn binding siteRING-H2 finger
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Comment:Based on the structural evidence that Mus musculus Deltex2 (1V87) binding two Zn2+ ions through its RING-H2 finger.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #  #             # #  #  #                                                    
gi 129785     824 KSCDECGKFLqikkFIVFPCGHCFHWNCIIRVIlnsndynlrqkte---------------------------------- 869
gi 353237773  910 ERCSCCNFPLftrqFYVFPCQHCFHADCLIGLVkeylpahalrkilllqaqllqannpeqangpttpsvlppapaprtqr 989
gi 459186078  793 DRCQSCDKLLltraFYLFPCQHAFHNDCMWKDVrpllidskrdladrlqqklltl------------------------- 847
gi 514691606  771 MMCDVCEYPLltraFYLFPCHHAFHKDCLMREVvkylppsqcrrvntirqdl---------------------------- 822
gi 350645570 1019 SRCTHCNHLLtlraFYVFPCGHNFHISCLTELVkpylsaeensklskale------------------------------ 1068
gi 74676125   835 ESCWHCNQPLfsepFVLFPCQHAFHRSCMLEKTyk--------------------------------------------- 869
gi 586727571  982 KTCRECNRPLytdsFYIFPCKHGFHQACLIYKVikndddqiklekintlnskieqiqksieslttrkrassedidi---- 1057
gi 553137378  870 EKCYVCGLPLlsrqFFVFPCQHAFHSDCLGKRVleqagpgkakrikecqvq----------------------------- 920
gi 551669960  855 QKCCFCRTPVlasaLFLFPCQHAFHISCQEEWMmremlgesdrrrvvelkaaiaa------------------------- 909
gi 154416900 2651 ELCEFCRQSLytdkFIVFPCHHALHIHCFLENMdlffepveqlnlia--------------------------------- 2697
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 129785         --------------------------------------------------------------------------------
gi 353237773  990 tllssqfgaangaanvpqskgpatnqvangrpasslitnpmggllavsmapvslgrnmfvaadrlkdmivpdalanaial 1069
gi 459186078      --------------------------------------------------------------------------------
gi 514691606      --------------------------------------------------------------------------------
gi 350645570      --------------------------------------------------------------------------------
gi 74676125       --------------------------------------------------------------------------------
gi 586727571 1058 --------------------------------------------------------------------------glfnnp 1063
gi 553137378      --------------------------------------------------------------------------------
gi 551669960      --------------------------------------------------------------------------------
gi 154416900      --------------------------------------------------------------------------------
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
Feature 1                                                      #  #     
gi 129785     870 ------------------------nflkakskhnlndLENIIVEKCGLCSDINI 899
gi 353237773 1070 pslpwggtganvptaggakkvkkgskedegaekvresLDELLASSCPLCESMVA 1123
gi 459186078  848 ---------------nlsndstskeerktarqklikdLDETIANECVLCGEIAV 886
gi 514691606  823 ------------------rdlpptaagarralalnakLDEIAGQDCIVCGEIAI 858
gi 350645570 1069 ---------------------sqnlgnnssisnfediFDEIIANDCVLCGHIAI 1101
gi 74676125   870 -----------------------------------laSEKNILKECQLCGPSYA 888
gi 586727571 1064 lnklvnfvashaieedneentvqleqyqkellkyreeLDQLLAIECIECGPSIV 1117
gi 553137378  921 --------------------isrglvkgrkreemigeLDGLVGEACILCSEYAI 954
gi 551669960  910 ----------------gqkqgrettsdtgglerlqaeLDDLLAADCPLCGGPAI 947
gi 154416900 2698 -----------------------lqanalkredtrakLIDALSKSCPFCGELSV 2728

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap